StarFunc result for job id Q9Y6V0

User Input

>input (1400 residues)
MGNEASLEGEGLPEGLAAAAAAGGGASGAGSPSHTAIPAGMEADLSQLSEEERRQIAAVM
SRAQGLPKGSVPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPGLSKSRTTDTFR
SEQKLPGRSPSTISLKESKSRTDLKEEHKSSMMPGFLSEVNALSAVSSVVNKFNPFDLIS
DSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDPLQQDGTPKSIS
SQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPS
PSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTK
PPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKP
LAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPP
PQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQPGSAKPS
AQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLPKTICPLCNTTELLLH
VPEKANFNTCTECQTTVCSLCGFNPNPHLTEVKEWLCLNCQMKRALGGDLAPVPSSPQPK
LKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQDLSKAPEPKKPPPLVKQPTLHGSPSAKA
KQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVKPTTDLVSSSSATTKPDIPS
SKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVSPFDSKAIPRPASDSKIISHPGPSSES
KGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPPGPRPTAGQTVPTPQQSPKPQE
QSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQPGPHSQSGP
GAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKETKAPAAEKLEPKAEQAPTVKR
TETEKKPPPIKDSKSLTAEPQKAVLPTKLEKSPKPESTCPLCKTELNIGSKDPPNFNTCT
ECKNQVCNLCGFNPTPHLTEIQEWLCLNCQTQRAISGQLGDIRKMPPAPSGPKASPMPVP
TESSSQKTAVPPQVKLVKKQEQEVKTEAEKVILEKVKETLSMEKIPPMVTTDQKQEESKL
EKDKASALQEKKPLPEEKKLIPEEEKIRSEEKKPLLEEKKPTPEDKKLLPEAKTSAPEEQ
KHDLLKSQVQIAEEKLEGRVAPKTVQEGKQPQTKMEGLPSGTPQSLPKEDDKTTKTIKEQ
PQPPCTAKPDQVEPGKEKTEKEDDKSDTSSSQQPKSPQGLSDTGYSSDGISSSLGEIPSL
IPTDEKDILKGLKKDSFSQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VXJ5	0.041	0.042	1.263E-4	1311	0.144	0.153	Q9VXJ5.pdb.gz	Q9VXJ5_DROME Disco-related, isoform A OS=Drosophila melanogaster OX=7227 GN=disco-r PE=4 SV=3
2	AFDB:Q8SY33	0.042	0.042	1.929E-3	1384	0.125	0.126	Q8SY33.pdb.gz	GAWKY_DROME Protein Gawky OS=Drosophila melanogaster OX=7227 GN=gw PE=1 SV=1
3	AFDB:Q9C0C2	0.032	0.029	2.062E-3	1729	0.165	0.134	Q9C0C2.pdb.gz	TB182_HUMAN 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4
4	AFDB:B1AYB6	0.038	0.037	3.072E-3	1498	0.149	0.140	B1AYB6.pdb.gz	MBD5_MOUSE Methyl-CpG-binding domain protein 5 OS=Mus musculus OX=10090 GN=Mbd5 PE=2 SV=1
5	AFDB:Q9C6N3	0.042	0.048	4.284E-3	1148	0.120	0.146	Q9C6N3.pdb.gz	Q9C6N3_ARATH RUN/FYVE domain protein OS=Arabidopsis thaliana OX=3702 GN=BPP5 PE=1 SV=1
6	AFDB:A0A0P0X9Z7	0.035	0.031	4.893E-3	1600	0.139	0.122	A0A0P0X9Z7.pdb.gz	CWZF7_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF7 PE=1 SV=2
7	AFDB:Q9EPQ8	0.044	0.036	4.893E-3	1987	0.181	0.127	Q9EPQ8.pdb.gz	TCF20_MOUSE Transcription factor 20 OS=Mus musculus OX=10090 GN=Tcf20 PE=1 SV=3
8	AFDB:Q10280	0.044	0.062	5.974E-3	855	0.103	0.168	Q10280.pdb.gz	GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gaf1 PE=1 SV=2
9	AFDB:Q9UPS6	0.036	0.029	7.293E-3	1966	0.181	0.129	Q9UPS6.pdb.gz	SET1B_HUMAN Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B PE=1 SV=3
10	AFDB:P47136	0.032	0.031	7.794E-3	1447	0.093	0.090	P47136.pdb.gz	BUD4_YEAST Bud site selection protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD4 PE=1 SV=2
11	PDB:2m1sA	0.024	0.207	8.257E-1	99	0.018	0.253	2m1sA.pdb.gz	Structural characterization of the Z RING-eIF4E complex reveals a distinct mode of control for eIF4E
12	PDB:4r8pL	0.025	0.121	1.406	254	0.012	0.067	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:5tteB	0.029	0.087	3.336	442	0.005	0.016	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
14	PDB:1b8tA	0.028	0.166	3.565	192	0.012	0.089	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
15	PDB:5z8lA	0.022	0.119	3.565	204	0.004	0.029	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
16	PDB:5o85D	0.019	0.386	3.811	53	0.007	0.189	5o85D.pdb.gz	The intricate network between the p34 and p44 subunits is central to the activity of the transcription/DNA repair factor TFIIH.
17	PDB:4c2mI	0.018	0.105	4.073	124	0.011	0.129	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
18	PDB:6gejS	0.023	0.127	4.073	208	0.007	0.048	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
19	PDB:7uhyA	0.021	0.036	4.073	771	0.009	0.016	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
20	PDB:7d58L	0.016	0.268	4.353	47	0.008	0.234	7d58L.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JKS6	0.0	1509	5085	0.688	0.189	PCLO_RAT Protein piccolo OS=Rattus norvegicus OX=10116 GN=Pclo PE=1 SV=1
2	Q9QYX7	0.0	1510	5068	0.676	0.187	PCLO_MOUSE Protein piccolo OS=Mus musculus OX=10090 GN=Pclo PE=1 SV=4
3	Q9Y6V0	0.0	2738	5142	1.000	0.272	PCLO_HUMAN Protein piccolo OS=Homo sapiens OX=9606 GN=PCLO PE=1 SV=5
4	Q9UPA5	2.24e-32	140	3926	0.064	0.023	BSN_HUMAN Protein bassoon OS=Homo sapiens OX=9606 GN=BSN PE=1 SV=4
5	O88737	4.52e-31	136	3942	0.061	0.022	BSN_MOUSE Protein bassoon OS=Mus musculus OX=10090 GN=Bsn PE=1 SV=4
6	O88778	1.06e-29	131	3938	0.064	0.023	BSN_RAT Protein bassoon OS=Rattus norvegicus OX=10116 GN=Bsn PE=1 SV=3
7	Q9H0J4	2.27e-12	74.7	1663	0.060	0.051	QRIC2_HUMAN Glutamine-rich protein 2 OS=Homo sapiens OX=9606 GN=QRICH2 PE=1 SV=1
8	P07476	1.60e-11	71.2	585	0.038	0.091	INVO_HUMAN Involucrin OS=Homo sapiens OX=9606 GN=IVL PE=1 SV=2
9	Q383H0	7.35e-08	59.7	1439	0.066	0.065	Q383H0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2880 PE=4 SV=1
10	Q960G6	2.83e-04	48.1	2409	0.044	0.026	Q960G6_DROME SD02860p OS=Drosophila melanogaster OX=7227 GN=teq PE=2 SV=1
11	P19246	2.98e-04	47.8	1090	0.062	0.080	NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus OX=10090 GN=Nefh PE=1 SV=3
12	Q9BI19	5.13e-04	47.4	2382	0.044	0.026	Q9BI19_DROME GRAAL2 protein OS=Drosophila melanogaster OX=7227 GN=teq PE=2 SV=1
13	E1JI93	5.26e-04	47.4	2379	0.044	0.026	E1JI93_DROME Tequila, isoform F OS=Drosophila melanogaster OX=7227 GN=teq PE=1 SV=2
14	Q9VSU2	0.001	46.2	2792	0.044	0.022	Q9VSU2_DROME Tequila, isoform G OS=Drosophila melanogaster OX=7227 GN=teq PE=1 SV=4
15	Q6FUW3	0.003	44.7	975	0.059	0.084	Q6FUW3_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EPA3 PE=4 SV=1
16	B4UN33	0.005	43.9	1423	0.056	0.056	B4UN33_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K00170g PE=4 SV=1
17	Q6FUW4	0.008	43.5	1420	0.064	0.063	Q6FUW4_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EPA2 PE=4 SV=1
18	Q38BJ2	0.064	40.4	1183	0.027	0.032	Q38BJ2_TRYB2 3-hydroxyacyl-CoA dehydrogenase C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3190 PE=4 SV=1
19	P16884	0.64	37.0	1072	0.060	0.078	NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus OX=10116 GN=Nefh PE=1 SV=4
20	P47708	1.1	36.2	681	0.016	0.032	RP3A_MOUSE Rabphilin-3A OS=Mus musculus OX=10090 GN=Rph3a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02318 FYVE_2	5.5e-05	34.7	FYVE-type zinc finger
2	PF01485 IBR	1.2e+02	14.2	IBR domain, a half RING-finger domain
3	PF05715 zf-piccolo	7.4e-55	194.4	Piccolo Zn-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334319

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380271	0.979	Rap guanine nucleotide exchange factor 4
2	9606.ENSP00000222256	0.908	Ras-related protein Rab-3A
3	9606.ENSP00000222008	0.874	Prenylated Rab acceptor protein 1
4	9606.ENSP00000468263	0.841	ELKS/Rab6-interacting/CAST family member 1
5	9606.ENSP00000288221	0.808	ERC protein 2
6	9606.ENSP00000367756	0.772	Protein unc-13 homolog B
7	9606.ENSP00000378338	0.739	ARF GTPase-activating protein GIT1
8	9606.ENSP00000429562	0.728	Protein unc-13 homolog A
9	9606.ENSP00000335614	0.713	Liprin-alpha-3
10	9606.ENSP00000311825	0.673	C-terminal-binding protein 2
11	9606.ENSP00000254976	0.670	Synaptosomal-associated protein 25
12	9606.ENSP00000253925	0.650	Liprin-alpha-1
13	9606.ENSP00000262189	0.639	Histone-lysine N-methyltransferase 2C
14	9606.ENSP00000344465	0.625	Platelet endothelial aggregation receptor 1
15	9606.ENSP00000303212	0.613	Semaphorin-3E
16	9606.ENSP00000370593	0.612	Receptor-type tyrosine-protein phosphatase delta
17	9606.ENSP00000260323	0.595	Protein unc-13 homolog C
18	9606.ENSP00000282878	0.594	Ras-related protein Rab-3C
19	9606.ENSP00000424571	0.587	Fibrillin-2
20	9606.ENSP00000239940	0.586	Profilin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.976	cellular process
GO:0065007	0.974	biological regulation
GO:0034330	0.937	cell junction organization
GO:0050789	0.918	regulation of biological process
GO:0050794	0.894	regulation of cellular process
GO:0065008	0.821	regulation of biological quality
GO:0051049	0.817	regulation of transport
GO:0050808	0.561	synapse organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0098831	0.997	presynaptic active zone cytoplasmic component
GO:0043227	0.992	membrane-bounded organelle
GO:0043229	0.991	intracellular organelle
GO:0043232	0.869	intracellular non-membrane-bounded organelle
GO:0005856	0.842	cytoskeleton
GO:0031982	0.828	vesicle
GO:0030863	0.808	cortical cytoskeleton
GO:0099569	0.800	presynaptic cytoskeleton
GO:0048788	0.794	cytoskeleton of presynaptic active zone
GO:0043231	0.663	intracellular membrane-bounded organelle
GO:0005576	0.650	extracellular region
GO:0012505	0.602	endomembrane system
GO:0005615	0.354	extracellular space
GO:1903561	0.328	extracellular vesicle
GO:0005886	0.316	plasma membrane
GO:0070062	0.309	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]