StarFunc result for job id Q9Y6W5

User Input

>input (498 residues)
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANT
FASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPV
LETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVEN
VDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHP
PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPD
FAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPL
SDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVE
YSDSEDDSSEFDEDDWSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6W5	1.000	1.000	7.189E-68	498	1.000	1.000	Q9Y6W5.pdb.gz	WASF2_HUMAN Actin-binding protein WASF2 OS=Homo sapiens OX=9606 GN=WASF2 PE=1 SV=3
2	AFDB:Q9UPY6	0.491	0.488	7.836E-32	502	0.506	0.502	Q9UPY6.pdb.gz	WASF3_HUMAN Actin-binding protein WASF3 OS=Homo sapiens OX=9606 GN=WASF3 PE=1 SV=2
3	AFDB:Q0IIJ3	0.397	0.355	2.474E-28	559	0.550	0.490	Q0IIJ3.pdb.gz	WASF1_BOVIN Actin-binding protein WASF1 OS=Bos taurus OX=9913 GN=WASF1 PE=2 SV=1
4	AFDB:Q9VKM2	0.407	0.336	9.190E-24	613	0.402	0.326	Q9VKM2.pdb.gz	Q9VKM2_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
5	AFDB:X2J5L4	0.359	0.280	9.029E-23	647	0.414	0.318	X2J5L4.pdb.gz	X2J5L4_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
6	AFDB:F2FB81	0.342	0.255	9.421E-22	674	0.398	0.294	F2FB81.pdb.gz	F2FB81_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
7	PDB:4n78D	0.311	0.751	1.163E-16	202	0.245	0.604	4n78D.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
8	AFDB:Q54NF8	0.343	0.383	1.022E-12	443	0.283	0.318	Q54NF8.pdb.gz	SCAR_DICDI Protein SCAR OS=Dictyostelium discoideum OX=44689 GN=scrA PE=1 SV=1
9	AFDB:Q6AWX6	0.305	0.194	1.708E-7	821	0.129	0.078	Q6AWX6.pdb.gz	SCAR1_ARATH Protein SCAR1 OS=Arabidopsis thaliana OX=3702 GN=SCAR1 PE=1 SV=1
10	AFDB:Q9LP46	0.271	0.143	1.401E-6	1020	0.120	0.059	Q9LP46.pdb.gz	SCAR3_ARATH Protein SCAR3 OS=Arabidopsis thaliana OX=3702 GN=SCAR3 PE=1 SV=1
11	AFDB:Q95Y80	0.056	0.042	1.071E-1	853	0.161	0.094	Q95Y80.pdb.gz	BET1_CAEEL Bromodomain-containing protein bet-1 OS=Caenorhabditis elegans OX=6239 GN=bet-1 PE=1 SV=3
12	PDB:6wg3C	0.047	0.084	7.324E-1	248	0.048	0.097	6wg3C.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
13	PDB:7nacw	0.074	0.055	3.714	672	0.034	0.025	7nacw.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
14	PDB:7qenC	0.052	0.085	5.017	291	0.052	0.089	7qenC.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
15	PDB:6pkwB	0.082	0.046	5.658	986	0.018	0.009	6pkwB.pdb.gz
16	PDB:7apkM	0.100	0.092	7.196	549	0.042	0.038	7apkM.pdb.gz
17	PDB:7yziA	0.078	0.100	7.196	378	0.018	0.024	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
18	PDB:4n78F	0.116	0.347	7.642	156	0.046	0.147	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
19	PDB:6n8jb	0.046	0.038	8.619	647	0.050	0.039	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
20	PDB:6qlfU	0.097	0.214	8.619	171	0.046	0.135	6qlfU.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BH43	0.0	592	497	0.861	0.863	WASF2_MOUSE Actin-binding protein WASF2 OS=Mus musculus OX=10090 GN=Wasf2 PE=1 SV=1
2	Q9Y6W5	0.0	980	498	1.000	1.000	WASF2_HUMAN Actin-binding protein WASF2 OS=Homo sapiens OX=9606 GN=WASF2 PE=1 SV=3
3	Q9UPY6	6.99e-108	332	502	0.500	0.496	WASF3_HUMAN Actin-binding protein WASF3 OS=Homo sapiens OX=9606 GN=WASF3 PE=1 SV=2
4	Q5BJU7	6.24e-94	297	559	0.295	0.263	WASF1_RAT Actin-binding protein WASF1 OS=Rattus norvegicus OX=10116 GN=Wasf1 PE=1 SV=1
5	Q8R5H6	7.24e-94	297	559	0.295	0.263	WASF1_MOUSE Actin-binding protein WASF1 OS=Mus musculus OX=10090 GN=Wasf1 PE=1 SV=2
6	Q0IIJ3	9.87e-94	297	559	0.295	0.263	WASF1_BOVIN Actin-binding protein WASF1 OS=Bos taurus OX=9913 GN=WASF1 PE=2 SV=1
7	Q92558	9.98e-94	297	559	0.295	0.263	WASF1_HUMAN Actin-binding protein WASF1 OS=Homo sapiens OX=9606 GN=WASF1 PE=1 SV=1
8	Q8VHI6	1.20e-89	285	501	0.275	0.273	WASF3_MOUSE Actin-binding protein WASF3 OS=Mus musculus OX=10090 GN=Wasf3 PE=1 SV=1
9	Q9VKM2	6.23e-59	207	613	0.197	0.160	Q9VKM2_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
10	M9NCT2	8.98e-59	207	640	0.197	0.153	M9NCT2_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
11	M9PCP4	1.13e-58	206	632	0.197	0.155	M9PCP4_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
12	H5V8D0	1.19e-58	206	641	0.197	0.153	H5V8D0_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
13	X2J5L4	1.30e-58	206	647	0.197	0.151	X2J5L4_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
14	F2FB81	1.70e-58	207	674	0.197	0.145	F2FB81_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
15	Q9XVK6	4.85e-48	174	468	0.173	0.184	Q9XVK6_CAEEL Wiskott-Aldrich syndrome protein family member OS=Caenorhabditis elegans OX=6239 GN=wve-1 PE=1 SV=2
16	Q5XPJ9	1.68e-09	63.2	1399	0.096	0.034	SCAR2_ARATH Protein SCAR2 OS=Arabidopsis thaliana OX=3702 GN=SCAR2 PE=1 SV=1
17	E7EXR7	1.54e-08	60.1	1606	0.094	0.029	E7EXR7_DANRE NHS-like 1b OS=Danio rerio OX=7955 GN=nhsl1b PE=1 SV=2
18	Q9LP46	7.81e-06	51.2	1020	0.082	0.040	SCAR3_ARATH Protein SCAR3 OS=Arabidopsis thaliana OX=3702 GN=SCAR3 PE=1 SV=1
19	Q9UQ16	0.19	37.0	869	0.054	0.031	DYN3_HUMAN Dynamin-3 OS=Homo sapiens OX=9606 GN=DNM3 PE=1 SV=4
20	P19835	0.95	34.7	753	0.106	0.070	CEL_HUMAN Bile salt-activated lipase OS=Homo sapiens OX=9606 GN=CEL PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18455 GBR2_CC	2.3e+02	13.1	Gamma-aminobutyric acid type B receptor subunit 2 coiled-coil domain
2	PF11945 WASH_WAHD	33	15.3	WAHD domain of WASH complex
3	PF02205 WH2	0.0016	29.4	WH2 motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483313

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316338	0.999	Brain-specific angiogenesis inhibitor 1-associated protein 2
2	9606.ENSP00000354251	0.999	Nck-associated protein 1
3	9606.ENSP00000365312	0.999	Abl interactor 1
4	9606.ENSP00000432472	0.999	Protein BRICK1
5	9606.ENSP00000444645	0.999	Cytoplasmic FMR1-interacting protein 2
6	9606.ENSP00000295851	0.997	Abl interactor 2
7	9606.ENSP00000481038	0.997	Cytoplasmic FMR1-interacting protein 1
8	9606.ENSP00000293373	0.993	Nck-associated protein 1-like
9	9606.ENSP00000367220	0.989	Actin-related protein 2
10	9606.ENSP00000451828	0.981	RAC-alpha serine/threonine-protein kinase
11	9606.ENSP00000348461	0.979	Ras-related C3 botulinum toxin substrate 1
12	9606.ENSP00000263238	0.976	Actin-related protein 3
13	9606.ENSP00000228825	0.974	Actin-related protein 2/3 complex subunit 3
14	9606.ENSP00000417273	0.973	Cytoplasmic protein NCK1
15	9606.ENSP00000295685	0.970	Actin-related protein 2/3 complex subunit 2
16	9606.ENSP00000365745	0.961	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
17	9606.ENSP00000365891	0.961	Wiskott-Aldrich syndrome protein
18	9606.ENSP00000361423	0.956	Tyrosine-protein kinase ABL1
19	9606.ENSP00000294742	0.948	Actin-related protein 2/3 complex subunit 5
20	9606.ENSP00000383178	0.948	Protein diaphanous homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003779	0.718	actin binding
GO:0051018	0.661	protein kinase A binding
GO:0045296	0.525	cadherin binding
GO:0017124	0.436	SH3 domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0048518	0.976	positive regulation of biological process
GO:0016043	0.975	cellular component organization
GO:0048522	0.970	positive regulation of cellular process
GO:0007154	0.958	cell communication
GO:0023052	0.957	signaling
GO:0030029	0.951	actin filament-based process
GO:0051716	0.946	cellular response to stimulus
GO:0030036	0.944	actin cytoskeleton organization
GO:0007165	0.923	signal transduction
GO:0051128	0.921	regulation of cellular component organization
GO:0044087	0.884	regulation of cellular component biogenesis
GO:0033043	0.884	regulation of organelle organization
GO:0051130	0.881	positive regulation of cellular component organization
GO:0051493	0.842	regulation of cytoskeleton organization
GO:0032970	0.827	regulation of actin filament-based process
GO:0032956	0.821	regulation of actin cytoskeleton organization
GO:0110053	0.782	regulation of actin filament organization
GO:0044089	0.747	positive regulation of cellular component biogenesis
GO:0048519	0.626	negative regulation of biological process
GO:0048523	0.585	negative regulation of cellular process
GO:0032502	0.450	developmental process
GO:0048856	0.442	anatomical structure development
GO:0032501	0.438	multicellular organismal process
GO:0120035	0.419	regulation of plasma membrane bounded cell projection organization
GO:0022607	0.347	cellular component assembly
GO:0120032	0.345	regulation of plasma membrane bounded cell projection assembly
GO:0051179	0.335	localization
GO:0120034	0.331	positive regulation of plasma membrane bounded cell projection assembly
GO:1902743	0.327	regulation of lamellipodium organization
GO:0010591	0.324	regulation of lamellipodium assembly
GO:1902745	0.324	positive regulation of lamellipodium organization
GO:0019222	0.320	regulation of metabolic process
GO:0010592	0.312	positive regulation of lamellipodium assembly
GO:0097435	0.302	supramolecular fiber organization
GO:0010638	0.302	positive regulation of organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0043229	1.000	intracellular organelle
GO:0031982	1.000	vesicle
GO:0120025	0.997	plasma membrane bounded cell projection
GO:0005576	0.996	extracellular region
GO:0005829	0.995	cytosol
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0031209	0.988	SCAR complex
GO:0031252	0.986	cell leading edge
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0030027	0.981	lamellipodium
GO:0016020	0.969	membrane
GO:0012505	0.967	endomembrane system
GO:0030054	0.962	cell junction
GO:0070062	0.945	extracellular exosome
GO:0015629	0.887	actin cytoskeleton
GO:0005634	0.877	nucleus
GO:0070161	0.838	anchoring junction
GO:0031410	0.734	cytoplasmic vesicle
GO:0071944	0.677	cell periphery
GO:0031974	0.606	membrane-enclosed lumen
GO:0005886	0.601	plasma membrane
GO:0070013	0.592	intracellular organelle lumen
GO:0031981	0.529	nuclear lumen
GO:0005654	0.484	nucleoplasm
GO:0005768	0.364	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]