StarFunc result for job id Q9Y6W8

User Input

>input (199 residues)
MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQ
ILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFK
VTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEY
MFMRAVNTAKKSRLTDVTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6W8	1.000	1.000	1.648E-34	199	1.000	1.000	Q9Y6W8.pdb.gz	ICOS_HUMAN Inducible T-cell costimulator OS=Homo sapiens OX=9606 GN=ICOS PE=1 SV=1
2	AFDB:Q9WVS0	0.766	0.763	1.443E-23	200	0.688	0.685	Q9WVS0.pdb.gz	ICOS_MOUSE Inducible T-cell costimulator OS=Mus musculus OX=10090 GN=Icos PE=1 SV=2
3	AFDB:Q9R1T7	0.577	0.574	2.944E-21	200	0.668	0.665	Q9R1T7.pdb.gz	ICOS_RAT Inducible T-cell costimulator OS=Rattus norvegicus OX=10116 GN=Icos PE=1 SV=1
4	AFDB:P10747	0.448	0.409	3.398E-9	220	0.226	0.205	P10747.pdb.gz	CD28_HUMAN T-cell-specific surface glycoprotein CD28 OS=Homo sapiens OX=9606 GN=CD28 PE=1 SV=1
5	AFDB:P31041	0.450	0.416	7.208E-9	218	0.196	0.179	P31041.pdb.gz	CD28_MOUSE T-cell-specific surface glycoprotein CD28 OS=Mus musculus OX=10090 GN=Cd28 PE=1 SV=2
6	AFDB:P16410	0.423	0.383	5.261E-8	223	0.146	0.130	P16410.pdb.gz	CTLA4_HUMAN Cytotoxic T-lymphocyte protein 4 OS=Homo sapiens OX=9606 GN=CTLA4 PE=1 SV=3
7	AFDB:P09793	0.426	0.385	1.243E-7	223	0.181	0.161	P09793.pdb.gz	CTLA4_MOUSE Cytotoxic T-lymphocyte protein 4 OS=Mus musculus OX=10090 GN=Ctla4 PE=1 SV=1
8	AFDB:A0A096MJE4	0.437	0.396	1.460E-7	223	0.191	0.170	A0A096MJE4.pdb.gz	A0A096MJE4_RAT Cytotoxic T-lymphocyte protein 4 OS=Rattus norvegicus OX=10116 GN=Ctla4 PE=4 SV=1
9	AFDB:Q02242	0.346	0.254	9.070E-7	288	0.121	0.083	Q02242.pdb.gz	PDCD1_MOUSE Programmed cell death protein 1 OS=Mus musculus OX=10090 GN=Pdcd1 PE=1 SV=1
10	AFDB:Q8BHK2	0.385	0.360	2.142E-6	215	0.151	0.140	Q8BHK2.pdb.gz	SCN3B_MOUSE Sodium channel subunit beta-3 OS=Mus musculus OX=10090 GN=Scn3b PE=1 SV=1
11	PDB:3oaiA	0.370	0.165	2.363E-4	488	0.085	0.035	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
12	PDB:6hd8A	0.350	0.166	1.063E-3	461	0.080	0.035	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
13	PDB:2qhrL	0.349	0.322	1.724E-3	218	0.060	0.055	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
14	PDB:6rulA	0.300	0.226	1.820E-3	276	0.055	0.040	6rulA.pdb.gz	Chemogenetic Control of Nanobodies.
15	PDB:3zhlA	0.378	0.576	2.512E-3	121	0.065	0.107	3zhlA.pdb.gz
16	PDB:6dlfA	0.301	0.262	2.512E-3	236	0.080	0.068	6dlfA.pdb.gz
17	PDB:1cd0A	0.332	0.555	3.860E-3	111	0.080	0.144	1cd0A.pdb.gz
18	PDB:6sm1A	0.346	0.572	3.860E-3	111	0.055	0.099	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
19	PDB:4aizA	0.321	0.556	4.298E-3	107	0.080	0.150	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
20	PDB:3bn9F	0.363	0.328	5.623E-3	224	0.065	0.058	3bn9F.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y6W8	3.72e-148	411	199	1.000	1.000	ICOS_HUMAN Inducible T-cell costimulator OS=Homo sapiens OX=9606 GN=ICOS PE=1 SV=1
2	Q9WVS0	7.68e-98	284	200	0.693	0.690	ICOS_MOUSE Inducible T-cell costimulator OS=Mus musculus OX=10090 GN=Icos PE=1 SV=2
3	Q9R1T7	9.64e-93	271	200	0.658	0.655	ICOS_RAT Inducible T-cell costimulator OS=Rattus norvegicus OX=10116 GN=Icos PE=1 SV=1
4	P31042	7.99e-10	58.5	218	0.206	0.188	CD28_RAT T-cell-specific surface glycoprotein CD28 OS=Rattus norvegicus OX=10116 GN=Cd28 PE=2 SV=1
5	P31041	2.88e-06	48.5	218	0.156	0.142	CD28_MOUSE T-cell-specific surface glycoprotein CD28 OS=Mus musculus OX=10090 GN=Cd28 PE=1 SV=2
6	P10747	1.41e-04	43.5	220	0.166	0.150	CD28_HUMAN T-cell-specific surface glycoprotein CD28 OS=Homo sapiens OX=9606 GN=CD28 PE=1 SV=1
7	A0A096MJE4	0.31	33.5	223	0.085	0.076	A0A096MJE4_RAT Cytotoxic T-lymphocyte protein 4 OS=Rattus norvegicus OX=10116 GN=Ctla4 PE=4 SV=1
8	Q62859	0.33	33.5	223	0.085	0.076	Q62859_RAT Cytotoxic T-lymphocyte protein 4 OS=Rattus norvegicus OX=10116 GN=Ctla4 PE=2 SV=1
9	P16410	0.41	33.1	223	0.146	0.130	CTLA4_HUMAN Cytotoxic T-lymphocyte protein 4 OS=Homo sapiens OX=9606 GN=CTLA4 PE=1 SV=3
10	P09793	0.60	32.7	223	0.156	0.139	CTLA4_MOUSE Cytotoxic T-lymphocyte protein 4 OS=Mus musculus OX=10090 GN=Ctla4 PE=1 SV=1
11	G3V7D2	1.6	31.2	174	0.070	0.080	G3V7D2_RAT Cytotoxic T-lymphocyte protein 4 OS=Rattus norvegicus OX=10116 GN=Ctla4 PE=4 SV=2
12	F4K0T5	5.7	30.0	624	0.116	0.037	F4K0T5_ARATH anthranilate synthase OS=Arabidopsis thaliana OX=3702 GN=ASA1 PE=1 SV=1
13	Q6DC22	7.2	29.6	494	0.186	0.075	Q6DC22_DANRE Glycine receptor beta subunit 2 OS=Danio rerio OX=7955 GN=glrb2 PE=1 SV=1
14	Q8WXR4	8.0	29.6	1341	0.111	0.016	MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens OX=9606 GN=MYO3B PE=1 SV=4
15	Q8L774	8.7	29.6	389	0.090	0.046	SLP1_ARATH Shewanella-like protein phosphatase 1 OS=Arabidopsis thaliana OX=3702 GN=SLP1 PE=1 SV=1
16	F4HNW0	8.9	29.6	400	0.090	0.045	F4HNW0_ARATH Calcineurin-like metallo-phosphoesterase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=SLP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07686 V-set	3.3e+02	12.9	Immunoglobulin V-set domain
2	PF15910 V-set_2	4.9e-56	199.1	ICOS V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319476

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339477	0.999	Inducible T-cell co-stimulator ligand
2	9606.ENSP00000483732	0.995	ICOS ligand
3	9606.ENSP00000359663	0.947	CD40 ligand
4	9606.ENSP00000428056	0.940	Phosphatidylinositol 3-kinase regulatory subunit alpha
5	9606.ENSP00000011653	0.850	T-cell surface glycoprotein CD4
6	9606.ENSP00000366563	0.833	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
7	9606.ENSP00000222254	0.809	Phosphatidylinositol 3-kinase regulatory subunit beta
8	9606.ENSP00000289153	0.806	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
9	9606.ENSP00000262741	0.803	Phosphatidylinositol 3-kinase regulatory subunit gamma
10	9606.ENSP00000263967	0.800	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
11	9606.ENSP00000303939	0.797	Cytotoxic T-lymphocyte protein 4
12	9606.ENSP00000356669	0.771	Roquin-1
13	9606.ENSP00000335062	0.732	Programmed cell death protein 1
14	9606.ENSP00000292174	0.731	C-X-C chemokine receptor type 5
15	9606.ENSP00000368538	0.698	Tumor necrosis factor receptor superfamily member 4
16	9606.ENSP00000398655	0.681	Tyrosine-protein kinase ITK/TSK
17	9606.ENSP00000358490	0.678	T-cell surface antigen CD2
18	9606.ENSP00000386559	0.655	T-cell surface glycoprotein CD8 alpha chain
19	9606.ENSP00000376345	0.654	Growth factor receptor-bound protein 2
20	9606.ENSP00000376911	0.652	Legumain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0002376	0.990	immune system process
GO:0030155	0.979	regulation of cell adhesion
GO:0048518	0.975	positive regulation of biological process
GO:0048522	0.972	positive regulation of cellular process
GO:0002684	0.970	positive regulation of immune system process
GO:0051240	0.946	positive regulation of multicellular organismal process
GO:0002694	0.910	regulation of leukocyte activation
GO:0032501	0.901	multicellular organismal process
GO:0051249	0.882	regulation of lymphocyte activation
GO:0022407	0.842	regulation of cell-cell adhesion
GO:1903037	0.832	regulation of leukocyte cell-cell adhesion
GO:0050867	0.818	positive regulation of cell activation
GO:0050896	0.801	response to stimulus
GO:0050863	0.762	regulation of T cell activation
GO:0045785	0.737	positive regulation of cell adhesion
GO:0002696	0.729	positive regulation of leukocyte activation
GO:0022409	0.700	positive regulation of cell-cell adhesion
GO:0051251	0.595	positive regulation of lymphocyte activation
GO:1903039	0.568	positive regulation of leukocyte cell-cell adhesion
GO:0048856	0.545	anatomical structure development
GO:0007155	0.520	cell adhesion
GO:0050870	0.517	positive regulation of T cell activation
GO:0051716	0.433	cellular response to stimulus
GO:0007154	0.428	cell communication
GO:0007165	0.418	signal transduction
GO:0048583	0.348	regulation of response to stimulus
GO:0007275	0.338	multicellular organism development
GO:0031295	0.322	T cell costimulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0009986	0.500	cell surface
GO:0005622	0.317	intracellular anatomical structure
GO:0043231	0.307	intracellular membrane-bounded organelle
GO:0005737	0.301	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]