StarFunc result for job id Q9Y6X0

User Input

>input (1596 residues)
MESRETLSSSRQRGGESDFLPVSSAKPPAAPGCAGEPLLSTPGPGKGIPVGGERMEPEEE
DELGSGRDVDSNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNL
ENYICPPEIKITIKQSGDQKVSRAGKNSKATKEEERSHSKKKLLTASDLAASDLKGFQPQ
AYERPQKHSTLHYDTGLPQDFTGDTLKPKHQQKSSSQNHMDWSTNSDSGPVTQNCFISPE
SGRETASTSKIPALEPVASFAKAQGKKGSAGNTWSQLSNNNKDLLLGGVAPSPSSHSSPA
PPSSSAECNGLQPLVDQDGGGTKEPPEPPTVGSKKKSSKKDVISQTIPNPDLDWVKNAQK
AFDNTEGKREGYSADSAQEASPARQNVSSASNPENDSSHVRITIPIKAPSLDPTNHKRKK
RQSIKAVVEKIMPEKALASGITMSSEVVNRILSNSEGNKKDPRVPKLSKMIENESPSVGL
ETGGNAEKVIPGGVSKPRKPPMVMTPPTCTDHSPSRKLPEIQHPKFAAKRRWTCSKPKPS
TMLREAVMATSDKLMLEPPSAYPITPSSPLYTNTDSLTVITPVKKKRGRPKKQPLLTVET
IHEGTSTSPVSPISREFPGTKKRKRRRNLAKLAQLVPGEDKPMSEMKFHKKVGKLGVLDK
KTIKTINKMKTLKRKNILNQILSCSSSVALKAKAPPETSPGAAAIESKLGKQINVSKRGT
IYIGKKRGRKPRAELPPPSEEPKTAIKHPRPVSSQPDVPAVPSNFQSLVASSPAAMHPLS
TQLGGSNGNLSPASTETNFSELKTMPNLQPISALPTKTQKGIHSGTWKLSPPRLMANSPS
HLCEIGSLKEITLSPVSESHSEETIPSDSGIGTDNNSTSDQAEKSSESRRRYSFDFCSLD
NPEAIPSDTSTKNRHGHRQKHLIVDNFLAHESLKKPKHKRKRKSLQNRDDLQFLADLEEL
ITKFQVFRISHRSYTFYHENPYPSIFRINFDHYYPVPYIQYDPLLYLRRTSDLKSKKKRG
RPAKTNDTMTKVPFLQGFSYPIPSGSYYAPYGMPYTSMPMMNLGYYGQYPAPLYLSHTLG
AASPFMRPTVPPPQFHTNSHVKMSGAAKHKAKHGVHLQGPVSMGLGDMQPSLNPPKVGSA
SLSSGRLHKRKHKHKHKHKEDRILGTHDNLSGLFAGKATGFSSHILSERLSSADKELPLV
SEKNKHKEKQKHQHSEAGHKASKNNFEVDTLSTLSLSDAQHWTQAKEKGDLSSEPVDSCT
KRYSGSGGDGGSTRSENLDVFSEMNPSNDKWDSDVSGSKRRSYEGFGTYREKDIQAFKMN
RKERSSYDSSMSPGMPSPHLKVDQTAVHSKNEGSVPTMMTRKKPAAVDSVTIPPAPVLSL
LAASAATSDAVGSSLKKRFKRREIEAIQCEVRKMCNYTKILSTKKNLDHVNKILKAKRLQ
RQSKTGNNFVKKRRGRPRKQPTQFDEDSRDQMPVLEKCIDLPSKRGQKPSLSPLVLEPAA
SQDTIMATIEAVIHMAREAPPLPPPPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAP
AQPPQQSPPQQPLPQEEEVKAKRQRKSRGSESEVLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6X0	0.999	0.999	0.000	1596	1.000	1.000	Q9Y6X0.pdb.gz	SETBP_HUMAN SET-binding protein OS=Homo sapiens OX=9606 GN=SETBP1 PE=1 SV=3
2	AFDB:Q9VRM6	0.040	0.035	3.406E-4	1929	0.163	0.135	Q9VRM6.pdb.gz	Q9VRM6_DROME Lethal (3) persistent salivary gland 2 OS=Drosophila melanogaster OX=7227 GN=l(3)psg2 PE=4 SV=2
3	AFDB:Q9VIQ9	0.033	0.028	1.086E-3	2197	0.164	0.119	Q9VIQ9.pdb.gz	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
4	AFDB:A0A0K3AUE4	0.038	0.032	3.461E-3	1968	0.148	0.120	A0A0K3AUE4.pdb.gz	SEA2_CAEEL Signal element on autosome protein 2 OS=Caenorhabditis elegans OX=6239 GN=sea-2 PE=1 SV=1
5	AFDB:Q5H9F3	0.030	0.028	3.705E-3	1711	0.140	0.131	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
6	AFDB:Q8NEY1	0.027	0.025	3.705E-3	1877	0.142	0.120	Q8NEY1.pdb.gz	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
7	AFDB:M9PGK7	0.036	0.029	4.867E-3	2272	0.142	0.099	M9PGK7.pdb.gz	M9PGK7_DROME Klarsicht, isoform E OS=Drosophila melanogaster OX=7227 GN=klar PE=1 SV=1
8	AFDB:F1R5H6	0.042	0.045	6.844E-3	1444	0.123	0.136	F1R5H6.pdb.gz	BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio OX=7955 GN=brd4 PE=1 SV=1
9	AFDB:Q3UH66	0.043	0.036	1.181E-2	2149	0.149	0.111	Q3UH66.pdb.gz	WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus musculus OX=10090 GN=Wnk2 PE=1 SV=2
10	AFDB:Q8IHQ2	0.036	0.041	3.068E-2	1301	0.092	0.113	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
11	PDB:4z7kB	0.017	0.131	2.652	195	0.003	0.026	4z7kB.pdb.gz	A Non-Stem-Loop CRISPR RNA Is Processed by Dual Binding Cas6.
12	PDB:4z7kA	0.019	0.125	3.254	218	0.004	0.032	4z7kA.pdb.gz	A Non-Stem-Loop CRISPR RNA Is Processed by Dual Binding Cas6.
13	PDB:7mqaSS	0.015	0.057	4.577	350	0.011	0.051	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y6X0	0.0	3258	1596	1.000	1.000	SETBP_HUMAN SET-binding protein OS=Homo sapiens OX=9606 GN=SETBP1 PE=1 SV=3
2	Q9Z180	0.0	2673	1582	0.892	0.899	SETBP_MOUSE SET-binding protein OS=Mus musculus OX=10090 GN=Setbp1 PE=1 SV=4
3	Q99MY8	1.23e-81	301	2958	0.139	0.075	ASH1L_MOUSE Histone-lysine N-methyltransferase ASH1L OS=Mus musculus OX=10090 GN=Ash1l PE=1 SV=3
4	Q9NR48	7.90e-22	106	2969	0.039	0.021	ASH1L_HUMAN Histone-lysine N-methyltransferase ASH1L OS=Homo sapiens OX=9606 GN=ASH1L PE=1 SV=2
5	Q8WZ42	9.1	33.5	34350	0.018	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282030

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385828	0.933	Thiosulfate sulfurtransferase
2	9606.ENSP00000377036	0.881	Serine/threonine-protein phosphatase 2A activator
3	9606.ENSP00000430269	0.859	Bifunctional epoxide hydrolase 2
4	9606.ENSP00000387498	0.846	Galactoside 2-alpha-L-fucosyltransferase 2
5	9606.ENSP00000366416	0.810	Endothelin receptor type B
6	9606.ENSP00000364839	0.805	Putative Polycomb group protein ASXL1
7	9606.ENSP00000263102	0.795	Coiled-coil domain containing 6
8	9606.ENSP00000264674	0.792	MDS1 and EVI1 complex locus protein EVI1
9	9606.ENSP00000373696	0.764	E3 ubiquitin-protein ligase TRIP12
10	9606.ENSP00000370288	0.759	Catalyzes the transfer of adenosine 5'-monophosphate (AMP) to Ser, Thr and Tyr residues of target proteins (AMPylation) . May be a redox-active mitochondrial selenoprotein which interacts with a redox target protein .
11	9606.ENSP00000303015	0.747	U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2
12	9606.ENSP00000376276	0.743	Serine/arginine-rich splicing factor 2
13	9606.ENSP00000292879	0.738	Splicing factor U2AF 35 kDa subunit-like protein
14	9606.ENSP00000307208	0.728	Nucleosome-remodeling factor subunit BPTF
15	9606.ENSP00000291552	0.724	U2 small nuclear RNA auxiliary factor 1
16	9606.ENSP00000485022	0.724	Splicing factor U2AF 35 kDa subunit
17	9606.ENSP00000442788	0.722	Methylcytosine dioxygenase TET2
18	9606.ENSP00000329097	0.712	PHD finger protein 6
19	9606.ENSP00000281821	0.698	Ephrin type-A receptor 4
20	9606.ENSP00000359206	0.696	F-box/WD repeat-containing protein 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.388	catalytic activity
GO:1901363	0.377	heterocyclic compound binding
GO:0097159	0.368	organic cyclic compound binding
GO:0003676	0.333	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.975	regulation of biological process
GO:0050794	0.970	regulation of cellular process
GO:0009987	0.918	cellular process
GO:0019222	0.828	regulation of metabolic process
GO:0048518	0.784	positive regulation of biological process
GO:0060255	0.784	regulation of macromolecule metabolic process
GO:0048519	0.768	negative regulation of biological process
GO:0080090	0.763	regulation of primary metabolic process
GO:0051171	0.762	regulation of nitrogen compound metabolic process
GO:0031323	0.762	regulation of cellular metabolic process
GO:0010468	0.740	regulation of gene expression
GO:0019219	0.724	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.655	regulation of DNA-templated transcription
GO:0048523	0.643	negative regulation of cellular process
GO:0048522	0.635	positive regulation of cellular process
GO:0032501	0.609	multicellular organismal process
GO:0008152	0.609	metabolic process
GO:0032502	0.608	developmental process
GO:0048856	0.601	anatomical structure development
GO:0043170	0.536	macromolecule metabolic process
GO:0044237	0.492	cellular metabolic process
GO:0009893	0.491	positive regulation of metabolic process
GO:0051173	0.468	positive regulation of nitrogen compound metabolic process
GO:0010604	0.466	positive regulation of macromolecule metabolic process
GO:0031325	0.461	positive regulation of cellular metabolic process
GO:0050896	0.430	response to stimulus
GO:0006357	0.391	regulation of transcription by RNA polymerase II
GO:0007275	0.356	multicellular organism development
GO:0006807	0.354	nitrogen compound metabolic process
GO:0044238	0.332	primary metabolic process
GO:0048513	0.308	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005829	0.977	cytosol
GO:0016604	0.684	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]