StarFunc result for job id Q9Y6X2

User Input

>input (628 residues)
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQGGDPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPG
GALREGHGGPLPSGPSLTGCRSDIISLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54714	0.721	0.721	0.000	628	0.970	0.970	O54714.pdb.gz	PIAS3_MOUSE E3 SUMO-protein ligase PIAS3 OS=Mus musculus OX=10090 GN=Pias3 PE=1 SV=3
2	AFDB:Q8N2W9	0.444	0.541	3.371E-56	510	0.379	0.467	Q8N2W9.pdb.gz	PIAS4_HUMAN E3 SUMO-protein ligase PIAS4 OS=Homo sapiens OX=9606 GN=PIAS4 PE=1 SV=1
3	AFDB:O94451	0.399	0.352	3.333E-31	727	0.201	0.173	O94451.pdb.gz	PLI1_SCHPO E3 SUMO-protein ligase pli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pli1 PE=1 SV=3
4	AFDB:Q12216	0.414	0.365	7.226E-28	726	0.182	0.157	Q12216.pdb.gz	SIZ2_YEAST E3 SUMO-protein ligase SIZ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NFI1 PE=1 SV=1
5	AFDB:A0A087WYL6	0.075	0.059	5.805E-2	1062	0.146	0.087	A0A087WYL6.pdb.gz	A0A087WYL6_HUMAN Par-3 family cell polarity regulator beta (Fragment) OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=1
6	PDB:3j4qB	0.064	0.087	1.614E-1	382	0.061	0.099	3j4qB.pdb.gz
7	PDB:4tlgA	0.056	0.078	2.038E-1	396	0.032	0.051	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
8	PDB:1ihmB	0.089	0.103	2.160E-1	511	0.053	0.065	1ihmB.pdb.gz
9	PDB:1kfuL	0.074	0.068	2.160E-1	699	0.029	0.026	1kfuL.pdb.gz
10	PDB:5jm0A	0.126	0.090	2.426E-1	940	0.030	0.020	5jm0A.pdb.gz
11	PDB:5vaeB	0.105	0.309	2.426E-1	134	0.024	0.112	5vaeB.pdb.gz
12	AFDB:A0A1D5NXF3	0.066	0.061	2.487E-1	732	0.154	0.133	A0A1D5NXF3.pdb.gz	A0A1D5NXF3_CHICK T-box 3 OS=Gallus gallus OX=9031 GN=TBX3 PE=4 SV=1
13	PDB:7kveB	0.069	0.037	2.726E-1	1374	0.019	0.009	7kveB.pdb.gz
14	PDB:7rdqD	0.053	0.030	2.889E-1	1366	0.040	0.018	7rdqD.pdb.gz	Structural and mechanistic basis of reiterative transcription initiation.
15	PDB:7sqyB	0.111	0.301	2.889E-1	175	0.035	0.126	7sqyB.pdb.gz
16	AFDB:Q9JIX8	0.061	0.032	3.326E-1	1338	0.166	0.078	Q9JIX8.pdb.gz	ACINU_MOUSE Apoptotic chromatin condensation inducer in the nucleus OS=Mus musculus OX=10090 GN=Acin1 PE=1 SV=3
17	PDB:5gm6a	0.093	0.408	3.440E-1	123	0.025	0.130	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	AFDB:O14367	0.066	0.060	6.309E-1	720	0.137	0.119	O14367.pdb.gz	GTI1_SCHPO Gluconate transport inducer 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gti1 PE=4 SV=1
19	AFDB:Q9N415	0.059	0.037	7.963E-1	1276	0.158	0.078	Q9N415.pdb.gz	Q9N415_CAEEL Variant SH3 domain protein OS=Caenorhabditis elegans OX=6239 GN=rimb-1 PE=1 SV=3
20	AFDB:Q6FX55	0.077	0.069	8.946E-1	715	0.119	0.105	Q6FX55.pdb.gz	Q6FX55_CANGA Candida glabrata strain CBS138 chromosome C complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EPA6 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y680	0.0	661	577	0.556	0.605	A0A8I5Y680_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=3 SV=1
2	A0A8I6AIY4	0.0	680	651	0.608	0.587	A0A8I6AIY4_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=3 SV=1
3	A0A8I6AJT7	0.0	672	658	0.602	0.574	A0A8I6AJT7_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=3 SV=1
4	A9UK05	0.0	679	651	0.608	0.587	A9UK05_RAT Protein inhibitor of activated STAT-1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=2 SV=1
5	G3V9T0	0.0	593	624	0.551	0.554	G3V9T0_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=1 SV=2
6	O54714	0.0	1235	628	0.970	0.970	PIAS3_MOUSE E3 SUMO-protein ligase PIAS3 OS=Mus musculus OX=10090 GN=Pias3 PE=1 SV=3
7	O70260	0.0	1233	628	0.967	0.967	PIAS3_RAT E3 SUMO-protein ligase PIAS3 OS=Rattus norvegicus OX=10116 GN=Pias3 PE=1 SV=2
8	O75925	0.0	677	651	0.605	0.584	PIAS1_HUMAN E3 SUMO-protein ligase PIAS1 OS=Homo sapiens OX=9606 GN=PIAS1 PE=1 SV=2
9	O75928	0.0	627	621	0.548	0.554	PIAS2_HUMAN E3 SUMO-protein ligase PIAS2 OS=Homo sapiens OX=9606 GN=PIAS2 PE=1 SV=3
10	O88907	0.0	681	651	0.610	0.588	PIAS1_MOUSE E3 SUMO-protein ligase PIAS1 OS=Mus musculus OX=10090 GN=Pias1 PE=1 SV=2
11	Q5QGZ1	0.0	671	564	0.567	0.631	Q5QGZ1_CHICK PIAS1 OS=Gallus gallus OX=9031 GN=PIAS1 PE=2 SV=1
12	Q6AZ28	0.0	617	572	0.535	0.587	PIAS2_RAT E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus OX=10116 GN=Pias2 PE=1 SV=1
13	Q6IAR4	0.0	1254	619	0.986	1.000	Q6IAR4_HUMAN PIAS3 protein OS=Homo sapiens OX=9606 GN=PIAS3 PE=2 SV=1
14	Q8C5D8	0.0	624	621	0.545	0.551	PIAS2_MOUSE E3 SUMO-protein ligase PIAS2 OS=Mus musculus OX=10090 GN=Pias2 PE=1 SV=2
15	Q9Y6X2	0.0	1272	628	1.000	1.000	PIAS3_HUMAN E3 SUMO-protein ligase PIAS3 OS=Homo sapiens OX=9606 GN=PIAS3 PE=1 SV=2
16	Q8N2W9	3.49e-139	417	510	0.355	0.437	PIAS4_HUMAN E3 SUMO-protein ligase PIAS4 OS=Homo sapiens OX=9606 GN=PIAS4 PE=1 SV=1
17	Q9JM05	2.21e-137	412	507	0.354	0.438	PIAS4_MOUSE E3 SUMO-protein ligase PIAS4 OS=Mus musculus OX=10090 GN=Pias4 PE=1 SV=2
18	A0A0B4JCQ7	3.47e-125	382	537	0.342	0.400	A0A0B4JCQ7_DROME Suppressor of variegation 2-10, isoform K OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
19	Q5BIG7	7.67e-125	381	533	0.342	0.403	Q5BIG7_DROME RE55465p OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
20	A0A0B4LEH9	9.51e-125	382	577	0.342	0.373	A0A0B4LEH9_DROME Suppressor of variegation 2-10, isoform N OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14324 PINIT	4.9e-30	116.2	PINIT domain
2	PF02891 zf-MIZ	3.8e-16	69.9	MIZ/SP-RING zinc finger
3	PF11789 zf-Nse	0.33	22.2	Zinc-finger of the MIZ type in Nse subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376765

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264657	0.999	Signal transducer and activator of transcription 3
2	9606.ENSP00000348056	0.995	SUMO-conjugating enzyme UBC9
3	9606.ENSP00000376077	0.993	Small ubiquitin-related modifier 1
4	9606.ENSP00000405965	0.992	Small ubiquitin-related modifier 2
5	9606.ENSP00000384273	0.990	Transcription factor p65
6	9606.ENSP00000295600	0.989	Microphthalmia-associated transcription factor
7	9606.ENSP00000263253	0.986	Histone acetyltransferase p300
8	9606.ENSP00000409666	0.980	Small ubiquitin-like modifier 3
9	9606.ENSP00000332973	0.979	Mothers against decapentaplegic homolog 3
10	9606.ENSP00000262160	0.960	Mothers against decapentaplegic homolog 2
11	9606.ENSP00000262367	0.955	CREB-binding protein
12	9606.ENSP00000268489	0.950	Zinc finger homeobox protein 3
13	9606.ENSP00000343204	0.945	Tyrosine-protein kinase JAK1
14	9606.ENSP00000313950	0.940	Aurora kinase B
15	9606.ENSP00000405330	0.939	Estrogen receptor
16	9606.ENSP00000341551	0.938	Mothers against decapentaplegic homolog 4
17	9606.ENSP00000385675	0.937	Interleukin-6
18	9606.ENSP00000325120	0.931	Progesterone receptor
19	9606.ENSP00000468785	0.930	Methyl-CpG-binding domain protein 1
20	9606.ENSP00000358262	0.928	Chromodomain-helicase-DNA-binding protein 1-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019789	1.000	SUMO transferase activity
GO:0019899	0.763	enzyme binding
GO:0008134	0.712	transcription factor binding
GO:0140297	0.622	DNA-binding transcription factor binding
GO:0003676	0.379	nucleic acid binding
GO:0003677	0.336	DNA binding
GO:0061629	0.324	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0050789	0.995	regulation of biological process
GO:0006807	0.992	nitrogen compound metabolic process
GO:0043170	0.988	macromolecule metabolic process
GO:0080090	0.988	regulation of primary metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0009987	0.987	cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0050896	0.982	response to stimulus
GO:0050794	0.982	regulation of cellular process
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0036211	0.959	protein modification process
GO:0048519	0.952	negative regulation of biological process
GO:0009893	0.947	positive regulation of metabolic process
GO:0018193	0.926	peptidyl-amino acid modification
GO:0018205	0.924	peptidyl-lysine modification
GO:0010604	0.920	positive regulation of macromolecule metabolic process
GO:0031323	0.918	regulation of cellular metabolic process
GO:0010468	0.915	regulation of gene expression
GO:0070647	0.905	protein modification by small protein conjugation or removal
GO:0032446	0.898	protein modification by small protein conjugation
GO:0019219	0.877	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.858	regulation of RNA metabolic process
GO:0010556	0.856	regulation of macromolecule biosynthetic process
GO:0031326	0.856	regulation of cellular biosynthetic process
GO:0006355	0.846	regulation of DNA-templated transcription
GO:0016925	0.827	protein sumoylation
GO:0051716	0.826	cellular response to stimulus
GO:0048522	0.744	positive regulation of cellular process
GO:0051173	0.724	positive regulation of nitrogen compound metabolic process
GO:0048523	0.717	negative regulation of cellular process
GO:0010605	0.650	negative regulation of macromolecule metabolic process
GO:0023052	0.645	signaling
GO:0051172	0.626	negative regulation of nitrogen compound metabolic process
GO:0007165	0.617	signal transduction
GO:0044237	0.589	cellular metabolic process
GO:0006357	0.567	regulation of transcription by RNA polymerase II
GO:0031324	0.509	negative regulation of cellular metabolic process
GO:0051246	0.464	regulation of protein metabolic process
GO:0042221	0.454	response to chemical
GO:0031325	0.418	positive regulation of cellular metabolic process
GO:0045934	0.389	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.369	negative regulation of RNA metabolic process
GO:0045892	0.363	negative regulation of DNA-templated transcription
GO:0007166	0.362	cell surface receptor signaling pathway
GO:0031399	0.358	regulation of protein modification process
GO:0051247	0.354	positive regulation of protein metabolic process
GO:1903320	0.333	regulation of protein modification by small protein conjugation or removal
GO:0010033	0.329	response to organic substance
GO:0070887	0.319	cellular response to chemical stimulus
GO:0048583	0.315	regulation of response to stimulus
GO:0051239	0.311	regulation of multicellular organismal process
GO:0045935	0.311	positive regulation of nucleobase-containing compound metabolic process
GO:0006950	0.308	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.930	cytoplasm
GO:0005829	0.522	cytosol
GO:0032991	0.466	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]