StarFunc result for job id Q9Y6X5

User Input

>input (453 residues)
MKLLVILLFSGLITGFRSDSSSSLPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVE
HVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIW
VTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTF
ATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGM
TQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIP
NRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGY
KHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCINLPEAIAIVIGSLLVLTM
LTCLIIIMQNRLSVPRPFSRLQLQEDDDDPLIG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6X5	0.999	0.999	6.123E-99	453	1.000	1.000	Q9Y6X5.pdb.gz	ENPP4_HUMAN Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Homo sapiens OX=9606 GN=ENPP4 PE=1 SV=3
2	AFDB:P84039	0.818	0.777	2.149E-59	477	0.457	0.434	P84039.pdb.gz	ENPP5_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Rattus norvegicus OX=10116 GN=Enpp5 PE=1 SV=2
3	AFDB:Q9UJA9	0.823	0.782	2.250E-58	477	0.453	0.430	Q9UJA9.pdb.gz	ENPP5_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Homo sapiens OX=9606 GN=ENPP5 PE=1 SV=1
4	PDB:5vemB	0.812	0.958	2.467E-56	383	0.439	0.520	5vemB.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.
5	PDB:5venA	0.810	0.959	1.503E-55	382	0.422	0.500	5venA.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.
6	AFDB:Q8BGN3	0.776	0.799	3.325E-43	440	0.309	0.318	Q8BGN3.pdb.gz	ENPP6_MOUSE Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Mus musculus OX=10090 GN=Enpp6 PE=1 SV=1
7	AFDB:Q6UWR7	0.779	0.802	6.071E-43	440	0.311	0.320	Q6UWR7.pdb.gz	ENPP6_HUMAN Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Homo sapiens OX=9606 GN=ENPP6 PE=1 SV=2
8	PDB:6wevAbA	0.786	0.444	2.905E-42	817	0.329	0.182	6wevAbA.pdb.gz	Crystal structures of human ENPP1 in apo and bound forms.
9	PDB:6c01A	0.781	0.439	5.985E-42	819	0.305	0.168	6c01A.pdb.gz	Structural basis for nucleotide recognition by the ectoenzyme CD203c.
10	AFDB:Q3TIW9	0.786	0.810	1.770E-41	439	0.298	0.308	Q3TIW9.pdb.gz	ENPP7_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Mus musculus OX=10090 GN=Enpp7 PE=1 SV=1
11	AFDB:O14638	0.780	0.410	1.880E-41	875	0.300	0.155	O14638.pdb.gz	ENPP3_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Homo sapiens OX=9606 GN=ENPP3 PE=1 SV=2
12	AFDB:Q6UWV6	0.784	0.776	4.639E-41	458	0.302	0.299	Q6UWV6.pdb.gz	ENPP7_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Homo sapiens OX=9606 GN=ENPP7 PE=1 SV=4
13	PDB:4b56A	0.787	0.444	6.656E-41	816	0.331	0.184	4b56A.pdb.gz	Structure of Npp1, an Ectonucleotide Pyrophosphatase/Phosphodiesterase Involved in Tissue Calcification.
14	AFDB:P97675	0.776	0.408	7.071E-41	875	0.302	0.157	P97675.pdb.gz	ENPP3_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Rattus norvegicus OX=10116 GN=Enpp3 PE=1 SV=2
15	PDB:6xkdB	0.788	0.530	4.054E-40	681	0.325	0.216	6xkdB.pdb.gz	Structure-Aided Development of Small-Molecule Inhibitors of ENPP1, the Extracellular Phosphodiesterase of the Immunotransmitter cGAMP.
16	AFDB:P22413	0.793	0.395	5.479E-40	925	0.331	0.162	P22413.pdb.gz	ENPP1_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Homo sapiens OX=9606 GN=ENPP1 PE=1 SV=2
17	PDB:3wayA	0.727	0.427	3.011E-36	787	0.294	0.169	3wayA.pdb.gz	Screening and X-ray Crystal Structure-based Optimization of Autotaxin (ENPP2) Inhibitors, Using a Newly Developed Fluorescence Probe
18	PDB:5s9mA	0.746	0.425	3.396E-36	809	0.289	0.162	5s9mA.pdb.gz	Crystal Structure of a rat Autotaxin complex
19	PDB:6g4gD	0.704	0.418	2.011E-33	781	0.272	0.157	6g4gD.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
20	PDB:6g4gC	0.695	0.434	4.142E-33	742	0.267	0.163	6g4gC.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y6X5	0.0	939	453	1.000	1.000	ENPP4_HUMAN Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Homo sapiens OX=9606 GN=ENPP4 PE=1 SV=3
2	Q9UJA9	2.82e-134	397	477	0.453	0.430	ENPP5_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Homo sapiens OX=9606 GN=ENPP5 PE=1 SV=1
3	P84039	4.07e-132	391	477	0.426	0.405	ENPP5_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Rattus norvegicus OX=10116 GN=Enpp5 PE=1 SV=2
4	Q9EQG7	6.57e-132	391	477	0.446	0.423	ENPP5_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Mus musculus OX=10090 GN=Enpp5 PE=1 SV=3
5	B2RBY8	1.33e-72	247	873	0.331	0.172	B2RBY8_HUMAN cDNA, FLJ95771, highly similar to Homo sapiens ectonucleotide pyrophosphatase/phosphodiesterase 1 (ENPP1), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
6	P22413	2.21e-72	247	925	0.331	0.162	ENPP1_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Homo sapiens OX=9606 GN=ENPP1 PE=1 SV=2
7	Q924C3	7.28e-72	245	906	0.331	0.166	ENPP1_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Rattus norvegicus OX=10116 GN=Enpp1 PE=1 SV=2
8	P06802	8.05e-72	245	906	0.333	0.167	ENPP1_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Mus musculus OX=10090 GN=Enpp1 PE=1 SV=4
9	Q9SU83	5.71e-68	226	496	0.320	0.292	Q9SU83_ARATH Alkaline-phosphatase-like family protein OS=Arabidopsis thaliana OX=3702 GN=At4g29680 PE=1 SV=1
10	Q8BGN3	8.45e-68	224	440	0.291	0.300	ENPP6_MOUSE Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Mus musculus OX=10090 GN=Enpp6 PE=1 SV=1
11	Q3TIW9	2.16e-67	223	439	0.305	0.314	ENPP7_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Mus musculus OX=10090 GN=Enpp7 PE=1 SV=1
12	P97675	3.10e-67	232	875	0.302	0.157	ENPP3_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Rattus norvegicus OX=10116 GN=Enpp3 PE=1 SV=2
13	O14638	3.65e-67	232	875	0.305	0.158	ENPP3_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Homo sapiens OX=9606 GN=ENPP3 PE=1 SV=2
14	Q6UWR7	6.55e-67	222	440	0.296	0.305	ENPP6_HUMAN Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Homo sapiens OX=9606 GN=ENPP6 PE=1 SV=2
15	Q5EZ72	1.34e-66	221	439	0.298	0.308	ENPP7_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Rattus norvegicus OX=10116 GN=Enpp7 PE=1 SV=1
16	Q6DYE8	6.96e-66	228	874	0.300	0.156	ENPP3_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Mus musculus OX=10090 GN=Enpp3 PE=1 SV=2
17	B0JZL7	1.18e-64	225	878	0.302	0.156	B0JZL7_DANRE Ectonucleotide pyrophosphatase/phosphodiesterase 1 OS=Danio rerio OX=7955 GN=si:ch211-142e24.2 PE=1 SV=1
18	Q6UWV6	1.04e-63	214	458	0.302	0.299	ENPP7_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Homo sapiens OX=9606 GN=ENPP7 PE=1 SV=4
19	Q9SU81	6.40e-60	204	461	0.289	0.284	Q9SU81_ARATH Alkaline-phosphatase-like family protein OS=Arabidopsis thaliana OX=3702 GN=At4g29700 PE=1 SV=1
20	Q64610	3.35e-55	199	887	0.305	0.156	ENPP2_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Rattus norvegicus OX=10116 GN=Enpp2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07394 DUF1501	4.4e+02	11.4	Protein of unknown function (DUF1501)
2	PF01676 Metalloenzyme	12	16.8	Metalloenzyme superfamily
3	PF08665 PglZ	78	14.8	PglZ domain
4	PF01663 Phosphodiest	5.4e-82	287.9	Type I phosphodiesterase / nucleotide pyrophosphatase
5	PF00884 Sulfatase	0.00013	33.1	Sulfatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318066

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417480	0.803	Bis(5'-adenosyl)-triphosphatase
2	9606.ENSP00000360515	0.716	Transcription initiation protein SPT3 homolog
3	9606.ENSP00000387292	0.709	Transmembrane protein 150A
4	9606.ENSP00000407560	0.688	Solute carrier family 25 member 44
5	9606.ENSP00000343339	0.667	P2X purinoceptor 2
6	9606.ENSP00000353032	0.660	P2X purinoceptor 4
7	9606.ENSP00000275072	0.657	Peptidase M20 domain containing 2
8	9606.ENSP00000385610	0.612	RNA-binding E3 ubiquitin-protein ligase MEX3C
9	9606.ENSP00000360532	0.597	Cell division cycle 5-like protein
10	9606.ENSP00000370201	0.573	Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. AMP and dAMP are the preferred substrates, but CMP and dCMP are also good substrates. IMP is phosphorylated to a much lesser extent. All nucleoside triphosphates ATP, GTP, UTP, CTP, dATP, dCTP, dGTP, and TTP are accepted as phosphate donors. CTP is the best phosphate donor, followed by UTP, ATP, GTP and dCTP. May have a role in nuclear energy homeostasis. Has also ATPase activity. May be involved in regulatio [...]
11	9606.ENSP00000365840	0.566	Ectonucleoside triphosphate diphosphohydrolase 6
12	9606.ENSP00000256649	0.550	Tripartite motif-containing protein 45
13	9606.ENSP00000438886	0.538	CDK5 regulatory subunit-associated protein 3
14	9606.ENSP00000416193	0.534	P2X purinoceptor 6
15	9606.ENSP00000416250	0.528	Translation initiation factor eIF-2B subunit alpha
16	9606.ENSP00000314099	0.523	Carbonic anhydrase 5B, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016462	0.999	pyrophosphatase activity
GO:0005515	0.995	protein binding
GO:0042578	0.965	phosphoric ester hydrolase activity
GO:0008081	0.928	phosphoric diester hydrolase activity
GO:0043167	0.860	ion binding
GO:0046872	0.814	metal ion binding
GO:0008270	0.489	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0071704	0.982	organic substance metabolic process
GO:0044238	0.972	primary metabolic process
GO:0065007	0.963	biological regulation
GO:0044237	0.948	cellular metabolic process
GO:0006807	0.926	nitrogen compound metabolic process
GO:0050789	0.905	regulation of biological process
GO:1901564	0.888	organonitrogen compound metabolic process
GO:0044282	0.828	small molecule catabolic process
GO:1901658	0.821	glycosyl compound catabolic process
GO:0034656	0.820	nucleobase-containing small molecule catabolic process
GO:0072523	0.807	purine-containing compound catabolic process
GO:0042454	0.805	ribonucleoside catabolic process
GO:0046128	0.801	purine ribonucleoside metabolic process
GO:0048518	0.531	positive regulation of biological process
GO:0050794	0.360	regulation of cellular process
GO:0048583	0.329	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.991	endomembrane system
GO:0005576	0.986	extracellular region
GO:0031090	0.955	organelle membrane
GO:1903561	0.948	extracellular vesicle
GO:0005615	0.945	extracellular space
GO:0070062	0.938	extracellular exosome
GO:0098588	0.768	bounding membrane of organelle
GO:0031410	0.749	cytoplasmic vesicle
GO:0030141	0.647	secretory granule
GO:0030659	0.635	cytoplasmic vesicle membrane
GO:0101002	0.600	ficolin-1-rich granule
GO:0070820	0.599	tertiary granule
GO:0030667	0.583	secretory granule membrane
GO:0070013	0.514	intracellular organelle lumen
GO:0101003	0.382	ficolin-1-rich granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.999	In phosphorus-containing anhydrides.
EC:3.1.-.-	0.965	Acting on ester bonds.
EC:3.1.4.-	0.928	Phosphoric diester hydrolases.

[back to server]