StarFunc result for job id Q9Y6X6

User Input

>input (1858 residues)
MEIDQCLLESLPLGQRQRLVKRMRCEQIKAYYEREKAFQKQEGFLKRLKHAKNPKVHFNL
TDMLQDAIIHHNDKEVLRLLKEGADPHTLVSSGGSLLHLCARYDNAFIAEILIDRGVNVN
HQDEDFWTPMHIACACDNPDIVLLLVLAGANVLLQDVNGNIPLDYAVEGTESSSILLTYL
DENGVDLTSLRQMKLQRPMSMLTDVKHFLSSGGNVNEKNDEGVTLLHMACASGYKEVVSL
ILEHGGDLNIVDDQYWTPLHLAAKYGQTNLVKLLLMHQANPHLVNCNEEKASDIAASEFI
EEMLLKAEIAWEEKMKEPLSASTLAQEEPYEEIIHDLPVLSSKLSPLVLPIAKQDSLLEK
DIMFKDATKGLCKQQSQDSIPENPMMSGSTKPEQVKLMPPAPNDDLATLSELNDGSLLYE
IQKRFGNNQIYTFIGDILLLVNPYKELPIYSSMVSQLYFSSSGKLCSSLPPHLFSCVERA
FHQLFREQRPQCFILSGERGSGKSEASKQIIRHLTCRAGASRATLDSRFKHVVCILEAFG
HAKTTLNDLSSCFIKYFELQFCERKQQLTGARIYTYLLEKSRLVSQPLGQSNFLIFYLLM
DGLSAEEKYGLHLNNLCAHRYLNQTIQDDASTGERSLNREKLAVLKRALNVVGFSSLEVE
NLFVILAAILHLGDIRFTALNEGNSAFVSDLQLLEQVAGMLQVSTDELASALTTDIQYFK
GDMIIRRHTIQIAEFFRDLLAKSLYSRLFSFLVNTMNSCLHSQDEQKSMQTLDIGILDIF
GFEEFQKNEFEQLCVNMTNEKMHHYINEVLFLHEQVECVQEGVTMETAYSPGNQNGVLDF
FFQKPSGFLTLLDEESQMIWSVESNFPKKLQSLLESSNTNAVYSPMKDGNGNVALKDHGT
AFTIMHYAGRVMYDVVGAIEKNKDSLSQNLLFVMKTSENVVINHLFQSKLSQTGSLVSAY
PSFKFRGHKSALLSKKMTASSIIGENKNYLELSKLLKKKGTSTFLQRLERGDPVTIASQL
RKSLMDIIGKLQKCTPHFIHCIRPNNSKLPDTFDNFYVSAQLQYIGVLEMVKIFRYGYPV
RLSFSDFLSRYKPLADTFLREKKEQSAAERCRLVLQQCKLQGWQMGVRKVFLKYWHADQL
NDLCLQLQRKIITCQKVIRGFLARQHLLQRISIRQQEVTSINSFLQNTEDMGLKTYDALV
IQNASDIARENDRLRSEMNAPYHKEKLEVRNMQEEGSKRTDDKSGPRHFHPSSMSVCAAV
DGLGQCLVGPSIWSPSLHSVFSMDDSSSLPSPRKQPPPKPKRDPNTRLSASYEAVSACLS
AAREAANEALARPRPHSDDYSTMKKIPPRKPKRSPNTKLSGSYEEISGSRPGDARPAGAP
GAAARVLTPGTPQCALPPAAPPGDEDDSEPVYIEMLGHAARPDSPDPGESVYEEMKCCLP
DDGGPGAGSFLLHGASPPLLHRAPEDEAAGPPGDACDIPPPFPNLLPHRPPLLVFPPTPV
TCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSSPLSPQYSKSQKGDGDRPASPGLAL
FNGSGRASPPSTPPPPPPPPGPPPAPYRPCAHLAFPPEPAPVNAGKAGPSAEAPKVHPKP
NSAPVAGPCSSFPKIPYSPVKATRADARKAGSSASPPAPYSPPSSRPLSSPLDELASLFN
SGRSVLRKSAAGRKIREAEGFETNMNISSRDDPSTSEITSETQDRNANNHGIQLSNSLSS
AITAENGNSISNGLPEEDGYSRLSISGTGTSTFQRHRDSHTTQVIHQLRLSENESVALQE
LLDWRRKLCEEGQDWQQILHHAEPRVPPPPPCKKPSLLKKPEGASCNRLPSELWDTTI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5DU14	0.600	0.582	0.000	1919	0.777	0.752	Q5DU14.pdb.gz	MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus OX=10090 GN=Myo16 PE=1 SV=2
2	AFDB:Q9Y6X6	1.000	1.000	0.000	1858	1.000	1.000	Q9Y6X6.pdb.gz	MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens OX=9606 GN=MYO16 PE=1 SV=3
3	PDB:4anjA	0.326	0.592	2.190E-46	995	0.117	0.219	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
4	PDB:4pa0B	0.297	0.577	7.846E-44	920	0.109	0.221	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
5	PDB:4pa0A	0.298	0.548	4.321E-43	974	0.111	0.211	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
6	PDB:6ycxB	0.333	0.727	6.109E-42	817	0.099	0.225	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
7	PDB:4p7hB	0.297	0.561	7.217E-41	952	0.106	0.207	4p7hB.pdb.gz
8	PDB:7mf3B	0.352	0.698	6.943E-38	896	0.125	0.259	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
9	AFDB:Q20456	0.338	0.248	5.029E-37	2577	0.158	0.114	Q20456.pdb.gz	Q20456_CAEEL Myosin motor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hum-4 PE=1 SV=6
10	PDB:5tbyA	0.319	0.582	7.892E-34	954	0.120	0.234	5tbyA.pdb.gz
11	AFDB:Q8IUG5	0.327	0.239	2.255E-27	2567	0.109	0.079	Q8IUG5.pdb.gz	MY18B_HUMAN Unconventional myosin-XVIIIb OS=Homo sapiens OX=9606 GN=MYO18B PE=1 SV=2
12	PDB:8cs9A	0.075	0.148	4.098E-11	796	0.039	0.092	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
13	AFDB:E9Q9B7	0.083	0.086	4.926E-11	1793	0.142	0.147	E9Q9B7.pdb.gz	E9Q9B7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
14	PDB:2dvwA	0.080	0.469	8.036E-11	229	0.033	0.266	2dvwA.pdb.gz
15	AFDB:O75179	0.089	0.068	1.710E-9	2603	0.149	0.106	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
16	PDB:4oauC	0.085	0.183	2.103E-8	692	0.032	0.085	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
17	AFDB:E9QEX9	0.085	0.065	2.209E-8	2607	0.160	0.114	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
18	AFDB:Q9P242	0.024	0.059	3.620E-8	653	0.136	0.387	Q9P242.pdb.gz	NYAP2_HUMAN Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 2 OS=Homo sapiens OX=9606 GN=NYAP2 PE=1 SV=3
19	AFDB:P16157	0.080	0.080	7.766E-8	1881	0.111	0.110	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
20	AFDB:Q8CIR4	0.066	0.063	6.244E-5	2028	0.130	0.119	Q8CIR4.pdb.gz	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5DU14	0.0	2422	1919	0.661	0.640	MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus OX=10090 GN=Myo16 PE=1 SV=2
2	Q9ERC1	0.0	2440	1912	0.663	0.644	MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus OX=10116 GN=Myo16 PE=1 SV=1
3	Q9Y6X6	0.0	3841	1858	1.000	1.000	MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens OX=9606 GN=MYO16 PE=1 SV=3
4	Q9DG88	4.57e-139	479	1838	0.151	0.152	Q9DG88_MORSA Myosin heavy chain FM3A OS=Morone saxatilis OX=34816 GN=FM3A PE=2 SV=1
5	Q1EG27	2.82e-138	467	1305	0.164	0.233	MYO3B_MOUSE Myosin-IIIb OS=Mus musculus OX=10090 GN=Myo3b PE=1 SV=2
6	Q8WXR4	5.83e-132	450	1341	0.146	0.202	MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens OX=9606 GN=MYO3B PE=1 SV=4
7	Q8NEV4	2.85e-129	447	1616	0.161	0.186	MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens OX=9606 GN=MYO3A PE=1 SV=2
8	Q8K3H5	6.40e-121	422	1613	0.140	0.161	MYO3A_MOUSE Myosin-IIIa OS=Mus musculus OX=10090 GN=Myo3a PE=1 SV=1
9	Q9QZZ4	4.28e-103	372	3511	0.147	0.078	MYO15_MOUSE Unconventional myosin-XV OS=Mus musculus OX=10090 GN=Myo15a PE=1 SV=2
10	Q9UKN7	4.53e-103	372	3530	0.139	0.073	MYO15_HUMAN Unconventional myosin-XV OS=Homo sapiens OX=9606 GN=MYO15A PE=1 SV=2
11	H2L082	8.29e-102	366	1867	0.137	0.136	H2L082_CAEEL Unconventional myosin-IXa-like OS=Caenorhabditis elegans OX=6239 GN=hum-7 PE=1 SV=1
12	A0A0G2K1F7	1.01e-101	367	3512	0.139	0.074	A0A0G2K1F7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
13	A0A0G2JTE7	1.15e-101	367	3494	0.139	0.074	A0A0G2JTE7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
14	F0IWT2	1.18e-101	365	1880	0.137	0.135	F0IWT2_CAEEL Unconventional myosin-IXa-like OS=Caenorhabditis elegans OX=6239 GN=hum-7 PE=1 SV=1
15	P34092	5.52e-100	351	1111	0.137	0.229	MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoB PE=1 SV=2
16	Q13402	3.02e-99	358	2215	0.131	0.110	MYO7A_HUMAN Unconventional myosin-VIIa OS=Homo sapiens OX=9606 GN=MYO7A PE=1 SV=2
17	Q6PIF6	5.01e-98	355	2116	0.133	0.117	MYO7B_HUMAN Unconventional myosin-VIIb OS=Homo sapiens OX=9606 GN=MYO7B PE=1 SV=2
18	P08799	5.33e-98	355	2116	0.130	0.114	MYS2_DICDI Myosin-2 heavy chain OS=Dictyostelium discoideum OX=44689 GN=mhcA PE=1 SV=3
19	Q9HD67	1.05e-97	353	2058	0.143	0.129	MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=3
20	F8VQB6	1.23e-97	353	2062	0.139	0.126	MYO10_MOUSE Unconventional myosin-X OS=Mus musculus OX=10090 GN=Myo10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	28	16.5	AAA ATPase domain
2	PF00023 Ank	3.2e-19	79.6	Ankyrin repeat
3	PF12796 Ank_2	2.9e-22	90.3	Ankyrin repeats (3 copies)
4	PF13606 Ank_3	3.4e-16	68.5	Ankyrin repeat
5	PF13637 Ank_4	2.8e-21	86.9	Ankyrin repeats (many copies)
6	PF13857 Ank_5	1.2e-18	78.2	Ankyrin repeats (many copies)
7	PF00612 IQ	8.7	17.4	IQ calmodulin-binding motif
8	PF00063 Myosin_head	1.3e-160	547.5	Myosin head (motor domain)
9	PF15452 NYAP_C	1.2	20.6	Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter
10	PF15439 NYAP_N	6.2e-122	419.3	Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter
11	PF06414 Zeta_toxin	1.8e+02	12.9	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401633

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254900	0.695	Bromodomain-containing protein 8
2	9606.ENSP00000437554	0.633	IQ motif and SEC7 domain-containing protein 3
3	9606.ENSP00000366715	0.617	Transmembrane protein 236
4	9606.ENSP00000379310	0.598	Protein phosphatase 1 regulatory subunits
5	9606.ENSP00000356379	0.567	Abnormal spindle-like microcephaly-associated protein
6	9606.ENSP00000352678	0.543	ATP-dependent RNA helicase SUPV3L1, mitochondrial
7	9606.ENSP00000303508	0.541	FERM domain-containing protein 3
8	9606.ENSP00000378690	0.514	Calcium-binding protein 8
9	9606.ENSP00000309953	0.510	EGF containing fibulin extracellular matrix protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0009987	0.988	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0048856	0.934	anatomical structure development
GO:0032501	0.916	multicellular organismal process
GO:0048523	0.849	negative regulation of cellular process
GO:0007275	0.798	multicellular organism development
GO:0050896	0.752	response to stimulus
GO:0048731	0.745	system development
GO:0071840	0.737	cellular component organization or biogenesis
GO:0016043	0.719	cellular component organization
GO:1901987	0.702	regulation of cell cycle phase transition
GO:0045786	0.699	negative regulation of cell cycle
GO:0007346	0.687	regulation of mitotic cell cycle
GO:1901990	0.680	regulation of mitotic cell cycle phase transition
GO:1901988	0.678	negative regulation of cell cycle phase transition
GO:0051716	0.665	cellular response to stimulus
GO:0007399	0.638	nervous system development
GO:1901991	0.620	negative regulation of mitotic cell cycle phase transition
GO:0007154	0.495	cell communication
GO:0007165	0.482	signal transduction
GO:0048518	0.328	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005654	0.993	nucleoplasm
GO:0016020	0.987	membrane
GO:0043232	0.955	intracellular non-membrane-bounded organelle
GO:0071944	0.946	cell periphery
GO:0005829	0.945	cytosol
GO:0005886	0.920	plasma membrane
GO:0048471	0.730	perinuclear region of cytoplasm
GO:0005856	0.705	cytoskeleton
GO:0032991	0.593	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]