StarFunc result for job id Q9Y6X9

User Input

>input (1032 residues)
MAFTNYSSLNRAQLTFEYLHTNSTTHEFLFGALAELVDNARDADATRIDIYAERREDLRG
GFMLCFLDDGAGMDPSDAASVIQFGKSAKRTPESTQIGQYGNGLKSGSMRIGKDFILFTK
KEDTMTCLFLSRTFHEEEGIDEVIVPLPTWNARTREPVTDNVEKFAIETELIYKYSPFRT
EEEVMTQFMKIPGDSGTLVIIFNLKLMDNGEPELDIISNPRDIQMAETSPEGTKPERRSF
RAYAAVLYIDPRMRIFIHGHKVQTKRLSCCLYKPRMYKYTSSRFKTRAEQEVKKAEHVAR
IAEEKAREAESKARTLEVRLGGDLTRDSRVMLRQVQNRAITLRREADVKKRIKEAKQRAL
KEPKELNFVFGVNIEHRDLDGMFIYNCSRLIKMYEKVGPQLEGGMACGGVVGVVDVPYLV
LEPTHNKQDFADAKEYRHLLRAMGEHLAQYWKDIAIAQRGIIKFWDEFGYLSANWNQPPS
SELRYKRRRAMEIPTTIQCDLCLKWRTLPFQLSSVEKDYPDTWVCSMNPDPEQDRCEASE
QKQKVPLGTFRKDMKTQEEKQKQLTEKIRQQQEKLEALQKTTPIRSQADLKKLPLEVTTR
PSTEEPVRRPQRPRSPPLPAVIRNAPSRPPSLPTPRPASQPRKAPVISSTPKLPALAARE
EASTSRLLQPPEAPRKPANTLVKTASRPAPLVQQLSPSLLPNSKSPREVPSPKVIKTPVV
KKTESPIKLSPATPSRKRSVAVSDEEEVEEEAERRKERCKRGRFVVKEEKKDSNELSDSA
GEEDSADLKRAQKDKGLHVEVRVNREWYTGRVTAVEVGKHVVRWKVKFDYVPTDTTPRDR
WVEKGSEDVRLMKPPSPEHQSLDTQQEGGEEEVGPVAQQAIAVAEPSTSECLRIEPDTTA
LSTNHETIDLLVQILRNCLRYFLPPSFPISKKQLSAMNSDELISFPLKEYFKQYEVGLQN
LCNSYQSRADSRAKASEESLRTSERKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDEL
DAYIEDLITKGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C5W4	0.571	0.577	0.000	1022	0.733	0.740	Q8C5W4.pdb.gz	MOR2B_MOUSE ATPase MORC2B OS=Mus musculus OX=10090 GN=Morc2b PE=1 SV=2
2	AFDB:Q9Y6X9	1.000	1.000	0.000	1032	1.000	1.000	Q9Y6X9.pdb.gz	MORC2_HUMAN ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2 PE=1 SV=2
3	AFDB:Q9WVL5	0.523	0.567	1.109E-72	950	0.377	0.409	Q9WVL5.pdb.gz	MORC1_MOUSE MORC family CW-type zinc finger protein 1 OS=Mus musculus OX=10090 GN=Morc1 PE=2 SV=1
4	AFDB:Q86VD1	0.533	0.558	1.135E-71	984	0.357	0.374	Q86VD1.pdb.gz	MORC1_HUMAN MORC family CW-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=MORC1 PE=2 SV=2
5	PDB:5tthA	0.239	0.352	1.821E-8	671	0.055	0.085	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
6	PDB:7kclB	0.233	0.370	2.899E-8	614	0.059	0.099	7kclB.pdb.gz	Cryo-EM reveals the dynamic interplay between mitochondrial Hsp90 and SdhB folding intermediates
7	PDB:5tthB	0.209	0.323	5.390E-8	621	0.058	0.097	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
8	PDB:2cg9B	0.198	0.312	1.515E-7	618	0.056	0.094	2cg9B.pdb.gz	Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
9	PDB:6rkwD	0.216	0.275	2.066E-7	781	0.058	0.077	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
10	PDB:5fwkA	0.203	0.312	4.723E-7	638	0.065	0.105	5fwkA.pdb.gz	Atomic Structure of Hsp90-Cdc37-Cdk4 Reveals that Hsp90 Traps and Stabilizes an Unfolded Kinase.
11	PDB:7p8vA	0.209	0.569	1.472E-6	331	0.056	0.175	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.
12	PDB:2zbkB	0.189	0.334	7.309E-6	506	0.065	0.132	2zbkB.pdb.gz	Crystal Structure of an Intact Type II DNA Topoisomerase: Insights into DNA Transfer Mechanisms
13	PDB:7kw7B	0.188	0.292	1.225E-5	628	0.060	0.099	7kw7B.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
14	PDB:2iopA	0.091	0.145	8.734E-5	618	0.059	0.099	2iopA.pdb.gz	Structural Analysis of E. coli hsp90 reveals dramatic nucleotide-dependent conformational rearrangements.
15	AFDB:F6TNN0	0.073	0.081	3.586E-1	922	0.075	0.084	F6TNN0.pdb.gz	F6TNN0_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 GN=nf-e2 PE=1 SV=2
16	AFDB:Q0DRX6	0.046	0.051	4.409E-1	902	0.068	0.078	Q0DRX6.pdb.gz	CWZF3_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF3 PE=1 SV=1
17	AFDB:Q9PTD7	0.061	0.048	4.889E-1	1360	0.077	0.058	Q9PTD7.pdb.gz	CING_XENLA Cingulin OS=Xenopus laevis OX=8355 GN=cgn PE=1 SV=3
18	AFDB:O88196	0.064	0.036	7.785E-1	1979	0.078	0.041	O88196.pdb.gz	TTC3_MOUSE E3 ubiquitin-protein ligase TTC3 OS=Mus musculus OX=10090 GN=Ttc3 PE=1 SV=2
19	AFDB:Q8RWR2	0.032	0.060	1.118	452	0.073	0.166	Q8RWR2.pdb.gz	LRP1B_ARATH La-related protein 1B OS=Arabidopsis thaliana OX=3702 GN=LARP1B PE=1 SV=2
20	AFDB:E7F4A6	0.052	0.068	1.524	745	0.097	0.134	E7F4A6.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q69ZX6	0.0	1806	1030	0.909	0.911	MOR2A_MOUSE ATPase MORC2A OS=Mus musculus OX=10090 GN=Morc2a PE=1 SV=2
2	Q86VD1	0.0	595	984	0.282	0.296	MORC1_HUMAN MORC family CW-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=MORC1 PE=2 SV=2
3	Q8C5W4	0.0	1523	1022	0.737	0.745	MOR2B_MOUSE ATPase MORC2B OS=Mus musculus OX=10090 GN=Morc2b PE=1 SV=2
4	Q9WVL5	0.0	604	950	0.282	0.306	MORC1_MOUSE MORC family CW-type zinc finger protein 1 OS=Mus musculus OX=10090 GN=Morc1 PE=2 SV=1
5	Q9Y6X9	0.0	2128	1032	1.000	1.000	MORC2_HUMAN ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2 PE=1 SV=2
6	H7C1V1	1.83e-126	384	191	0.184	0.995	H7C1V1_HUMAN MORC family CW-type zinc finger 2 (Fragment) OS=Homo sapiens OX=9606 GN=MORC2 PE=1 SV=1
7	Q23243	4.01e-50	193	845	0.141	0.173	MORC1_CAEEL ATPase morc-1 OS=Caenorhabditis elegans OX=6239 GN=morc-1 PE=1 SV=2
8	Q5FV35	1.26e-40	162	626	0.132	0.217	MORC2_ARATH Protein MICRORCHIDIA 2 OS=Arabidopsis thaliana OX=3702 GN=MORC2 PE=1 SV=1
9	F7BJB9	1.89e-40	164	942	0.100	0.109	MORC3_MOUSE MORC family CW-type zinc finger protein 3 OS=Mus musculus OX=10090 GN=Morc3 PE=1 SV=1
10	Q8TE76	2.35e-40	164	937	0.097	0.107	MORC4_HUMAN MORC family CW-type zinc finger protein 4 OS=Homo sapiens OX=9606 GN=MORC4 PE=1 SV=2
11	Q14149	4.25e-39	159	939	0.097	0.106	MORC3_HUMAN MORC family CW-type zinc finger protein 3 OS=Homo sapiens OX=9606 GN=MORC3 PE=1 SV=3
12	Q84WV6	1.42e-35	146	635	0.127	0.206	MORC1_ARATH Protein MICRORCHIDIA 1 OS=Arabidopsis thaliana OX=3702 GN=MORC1 PE=1 SV=1
13	F4KAF2	2.10e-35	147	800	0.092	0.119	MORC4_ARATH Protein MICRORCHIDIA 4 OS=Arabidopsis thaliana OX=3702 GN=MORC4 PE=1 SV=2
14	F4JRS4	1.54e-34	144	707	0.095	0.139	MORC7_ARATH Protein MICRORCHIDIA 7 OS=Arabidopsis thaliana OX=3702 GN=MORC7 PE=1 SV=1
15	Q56Y74	1.92e-31	134	663	0.092	0.143	MORC6_ARATH Protein MICRORCHIDIA 6 OS=Arabidopsis thaliana OX=3702 GN=MORC6 PE=1 SV=1
16	M9PB32	4.45e-05	50.4	19560	0.063	0.003	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PBZ0	5.50e-05	50.1	22830	0.063	0.003	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PBZ4	5.53e-05	50.1	18014	0.063	0.004	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PC45	5.69e-05	50.1	22300	0.063	0.003	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PEI1	5.83e-05	50.1	21657	0.063	0.003	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13589 HATPase_c_3	1.5e-25	101.2	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
2	PF17942 Morc6_S5	7.1e-20	82.9	Morc6 ribosomal protein S5 domain 2-like
3	PF07496 zf-CW	1e-11	55.9	CW-type Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003812094.2

Rank	PPI partner	STRING score	Description
1	9597.XP_003833045.1	0.666	M-phase phosphoprotein 8
2	9597.XP_008975472.1	0.606	Cell cycle and apoptosis regulator 2
3	9597.XP_003810206.1	0.591	Nucleoporin 88
4	9597.XP_003816144.1	0.591	HAUS augmin-like complex subunit 5
5	9597.XP_003815000.1	0.583	Specifically binds 5-hydroxymethylcytosine (5hmC), suggesting that it acts as a specific reader of 5hmC.
6	9597.XP_003819835.1	0.583	SHC SH2 domain-binding protein 1
7	9597.XP_003825783.1	0.558	Periphilin 1
8	9597.XP_003830586.1	0.533	Yip1 domain family member 2
9	9597.XP_008956278.1	0.503	GAS2-like protein 3 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0042393	0.994	histone binding
GO:0097159	0.991	organic cyclic compound binding
GO:1901363	0.990	heterocyclic compound binding
GO:0003824	0.951	catalytic activity
GO:0017111	0.929	ribonucleoside triphosphate phosphatase activity
GO:0016887	0.918	ATP hydrolysis activity
GO:0005524	0.871	ATP binding
GO:0003682	0.866	chromatin binding
GO:0000287	0.865	magnesium ion binding
GO:0042802	0.856	identical protein binding
GO:0008270	0.848	zinc ion binding
GO:0042803	0.827	protein homodimerization activity
GO:0003676	0.607	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0009987	0.985	cellular process
GO:2001141	0.983	regulation of RNA biosynthetic process
GO:0051128	0.980	regulation of cellular component organization
GO:0009890	0.973	negative regulation of biosynthetic process
GO:0120261	0.965	regulation of heterochromatin organization
GO:2001252	0.965	positive regulation of chromosome organization
GO:0044087	0.956	regulation of cellular component biogenesis
GO:0045069	0.945	regulation of viral genome replication
GO:0010468	0.943	regulation of gene expression
GO:0031445	0.931	regulation of heterochromatin formation
GO:0048523	0.917	negative regulation of cellular process
GO:0010558	0.916	negative regulation of macromolecule biosynthetic process
GO:0071840	0.912	cellular component organization or biogenesis
GO:0051172	0.909	negative regulation of nitrogen compound metabolic process
GO:0031327	0.909	negative regulation of cellular biosynthetic process
GO:0044089	0.898	positive regulation of cellular component biogenesis
GO:1902679	0.896	negative regulation of RNA biosynthetic process
GO:0045071	0.878	negative regulation of viral genome replication
GO:0016043	0.865	cellular component organization
GO:0050896	0.731	response to stimulus
GO:0008152	0.447	metabolic process
GO:0071704	0.441	organic substance metabolic process
GO:0044238	0.439	primary metabolic process
GO:0044237	0.427	cellular metabolic process
GO:0006807	0.406	nitrogen compound metabolic process
GO:0006950	0.379	response to stress
GO:0043170	0.370	macromolecule metabolic process
GO:0051716	0.320	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043228	0.975	non-membrane-bounded organelle
GO:0043232	0.974	intracellular non-membrane-bounded organelle
GO:0005829	0.958	cytosol
GO:0005694	0.906	chromosome
GO:0000785	0.887	chromatin
GO:0000792	0.609	heterochromatin
GO:0032991	0.484	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23680	0.929	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.929	nucleoside-triphosphate phosphatase.
RHEA:13065	0.918	ATP + H2O = ADP + H(+) + phosphate

[back to server]