StarFunc result for job id Q9Y6Y0

User Input

>input (642 residues)
MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEI
FNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQV
CGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEV
MLEDNVCLPSNGKLYTKVINWVQRSIWENGDSLEELMEEVQTLYYSADHKLLDGNLLDGQ
AEVFGSDDDHIQFVQKKPPRENGHKQISSSSTGCLSSPNATVQSPKHEWKIVASEKTSNN
TYLCLAVLDGIFCVIFLHGRNSPQSSPTSTPKLSKSLSFEMQQDELIEKPMSPMQYARSG
LGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVV
GGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSDPYGQKGLK
NCDVFDPVTKLWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWT
LIAPMNVARRGAGVAVLNGKLFVCGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAG
IATVGNTIYAVGGFDGNEFLNTVEVYNLESNEWSPYTKIFQF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q920Q8	0.835	0.835	0.000	642	0.970	0.970	Q920Q8.pdb.gz	NS1BP_MOUSE Influenza virus NS1A-binding protein homolog OS=Mus musculus OX=10090 GN=Ivns1abp PE=1 SV=2
2	AFDB:Q9VUU5	0.394	0.406	1.850E-47	623	0.282	0.291	Q9VUU5.pdb.gz	KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=dbo PE=1 SV=1
3	AFDB:Q6TDP4	0.406	0.406	2.069E-47	642	0.277	0.277	Q6TDP4.pdb.gz	KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=KLHL17 PE=1 SV=1
4	AFDB:Q9Y2M5	0.397	0.418	2.714E-46	609	0.277	0.292	Q9Y2M5.pdb.gz	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
5	AFDB:E9Q4F2	0.401	0.447	1.219E-44	574	0.246	0.275	E9Q4F2.pdb.gz	KLH18_MOUSE Kelch-like protein 18 OS=Mus musculus OX=10090 GN=Klhl18 PE=1 SV=1
6	AFDB:G5ED84	0.401	0.374	4.415E-44	690	0.235	0.219	G5ED84.pdb.gz	KLHL8_CAEEL Kelch-like protein 8 OS=Caenorhabditis elegans OX=6239 GN=kel-8 PE=1 SV=1
7	AFDB:Q53G59	0.400	0.451	4.415E-44	568	0.255	0.289	Q53G59.pdb.gz	KLH12_HUMAN Kelch-like protein 12 OS=Homo sapiens OX=9606 GN=KLHL12 PE=1 SV=2
8	AFDB:Q9JI74	0.400	0.343	1.022E-43	751	0.254	0.217	Q9JI74.pdb.gz	KLHL1_MOUSE Kelch-like protein 1 OS=Mus musculus OX=10090 GN=Klhl1 PE=2 SV=2
9	AFDB:A0A024R7C0	0.402	0.413	1.512E-43	624	0.269	0.277	A0A024R7C0.pdb.gz
10	AFDB:Q9P2G9	0.403	0.417	2.115E-43	620	0.235	0.244	Q9P2G9.pdb.gz	KLHL8_HUMAN Kelch-like protein 8 OS=Homo sapiens OX=9606 GN=KLHL8 PE=1 SV=4
11	PDB:2uvkB	0.398	0.707	5.361E-20	349	0.092	0.169	2uvkB.pdb.gz
12	PDB:5gqtA	0.378	0.507	8.796E-19	470	0.093	0.128	5gqtA.pdb.gz
13	PDB:5gq0A	0.391	0.716	6.973E-18	338	0.084	0.160	5gq0A.pdb.gz
14	PDB:2zwaB	0.366	0.345	4.109E-15	683	0.075	0.070	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
15	PDB:6dbjD	0.338	0.570	8.624E-10	352	0.059	0.108	6dbjD.pdb.gz	DNA melting initiates the RAG catalytic pathway.
16	PDB:6oemB	0.318	0.535	1.427E-9	346	0.070	0.130	6oemB.pdb.gz	Cutting antiparallel DNA strands in a single active site.
17	PDB:6wcqC	0.177	0.831	1.011E-8	130	0.058	0.285	6wcqC.pdb.gz
18	PDB:5y31B	0.312	0.377	1.415E-8	511	0.059	0.074	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
19	PDB:7d4iBE	0.262	0.199	3.663E-8	890	0.062	0.045	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
20	PDB:7bt6x	0.269	0.334	4.097E-8	488	0.064	0.084	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q920Q8	0.0	1307	642	0.970	0.970	NS1BP_MOUSE Influenza virus NS1A-binding protein homolog OS=Mus musculus OX=10090 GN=Ivns1abp PE=1 SV=2
2	Q9Y6Y0	0.0	1344	642	1.000	1.000	NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens OX=9606 GN=IVNS1ABP PE=1 SV=3
3	Q6TDP4	1.60e-78	264	642	0.263	0.263	KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=KLHL17 PE=1 SV=1
4	Q8K430	2.68e-78	263	640	0.263	0.264	KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus OX=10116 GN=Klhl17 PE=1 SV=1
5	Q9Y2M5	3.70e-77	259	609	0.266	0.281	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
6	Q9UH77	2.40e-75	254	587	0.266	0.291	KLHL3_HUMAN Kelch-like protein 3 OS=Homo sapiens OX=9606 GN=KLHL3 PE=1 SV=2
7	E0CZ16	5.52e-75	253	587	0.269	0.295	KLHL3_MOUSE Kelch-like protein 3 OS=Mus musculus OX=10090 GN=Klhl3 PE=1 SV=2
8	Q96PQ7	3.69e-74	254	755	0.265	0.225	KLHL5_HUMAN Kelch-like protein 5 OS=Homo sapiens OX=9606 GN=KLHL5 PE=1 SV=3
9	Q04652	7.68e-74	261	1477	0.269	0.117	KELC_DROME Ring canal kelch protein OS=Drosophila melanogaster OX=7227 GN=kel PE=1 SV=4
10	Q9JI74	2.79e-72	249	751	0.274	0.234	KLHL1_MOUSE Kelch-like protein 1 OS=Mus musculus OX=10090 GN=Klhl1 PE=2 SV=2
11	Q9NR64	3.18e-72	249	748	0.273	0.234	KLHL1_HUMAN Kelch-like protein 1 OS=Homo sapiens OX=9606 GN=KLHL1 PE=1 SV=1
12	O95198	3.55e-71	243	593	0.271	0.293	KLHL2_HUMAN Kelch-like protein 2 OS=Homo sapiens OX=9606 GN=KLHL2 PE=1 SV=2
13	A0A2R8Q1W5	1.84e-70	241	587	0.280	0.307	KEP1B_DANRE Kelch-like ECH-associated protein 1B OS=Danio rerio OX=7955 GN=keap1b PE=1 SV=1
14	Q5U374	2.53e-70	240	564	0.260	0.296	KLH12_DANRE Kelch-like protein 12 OS=Danio rerio OX=7955 GN=klhl12 PE=2 SV=2
15	Q8JZP3	2.64e-70	241	593	0.269	0.292	KLHL2_MOUSE Kelch-like protein 2 OS=Mus musculus OX=10090 GN=Klhl2 PE=2 SV=1
16	Q53G59	9.50e-70	238	568	0.254	0.287	KLH12_HUMAN Kelch-like protein 12 OS=Homo sapiens OX=9606 GN=KLHL12 PE=1 SV=2
17	Q9VGE5	8.42e-69	236	575	0.255	0.285	Q9VGE5_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=KLHL18 PE=2 SV=1
18	Q9VUU5	2.62e-65	228	623	0.245	0.252	KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=dbo PE=1 SV=1
19	Q9VEN5	3.87e-63	224	744	0.255	0.220	Q9VEN5_DROME Keap1, isoform A OS=Drosophila melanogaster OX=7227 GN=Keap1 PE=3 SV=1
20	Q9VGE6	7.20e-63	219	538	0.246	0.294	Q9VGE6_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=KLHL18 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07707 BACK	3.6e-09	48.0	BTB And C-terminal Kelch
2	PF00651 BTB	3.9e-23	93.2	BTB/POZ domain
3	PF01344 Kelch_1	6e-83	283.6	Kelch motif
4	PF07646 Kelch_2	1.7e-32	121.4	Kelch motif
5	PF13415 Kelch_3	2e-28	109.4	Galactose oxidase, central domain
6	PF13418 Kelch_4	4.9e-26	101.7	Galactose oxidase, central domain
7	PF13854 Kelch_5	7.5e-13	59.3	Kelch motif
8	PF13964 Kelch_6	3.1e-40	146.4	Kelch motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356468

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000234590	0.940	Alpha-enolase
2	9606.ENSP00000414624	0.917	Phosphoribosyl pyrophosphate synthase-associated protein 1
3	9606.ENSP00000365439	0.858	Heterogeneous nuclear ribonucleoprotein K
4	9606.ENSP00000233638	0.811	T-cell leukemia homeobox protein 2
5	9606.ENSP00000292476	0.750	Cleavage and polyadenylation specificity factor subunit 4
6	9606.ENSP00000481127	0.729	Proline dehydrogenase 1, mitochondrial
7	9606.ENSP00000375863	0.723	Heterogeneous nuclear ribonucleoprotein U-like protein 1
8	9606.ENSP00000356476	0.718	TRMT1-like protein
9	9606.ENSP00000359464	0.717	Opioid growth factor receptor like 1
10	9606.ENSP00000356470	0.708	Transcriptional protein SWT1
11	9606.ENSP00000264414	0.699	Cullin-3
12	9606.ENSP00000268835	0.659	Phosphoribosyl pyrophosphate synthase-associated protein 2
13	9606.ENSP00000376276	0.650	Serine/arginine-rich splicing factor 2
14	9606.ENSP00000352282	0.593	Kelch domain containing 1
15	9606.ENSP00000362608	0.578	Serine/threonine-protein kinase pim-1
16	9606.ENSP00000310448	0.561	U4/U6.U5 tri-snRNP-associated protein 1
17	9606.ENSP00000283179	0.549	Heterogeneous nuclear ribonucleoprotein U
18	9606.ENSP00000378015	0.541	Krev interaction trapped protein 1
19	9606.ENSP00000298307	0.538	Kelch domain-containing protein 2
20	9606.ENSP00000346120	0.537	Nucleolar RNA helicase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.994	regulation of biological process
GO:0044238	0.992	primary metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:0044237	0.984	cellular metabolic process
GO:0050794	0.970	regulation of cellular process
GO:0048519	0.969	negative regulation of biological process
GO:0019222	0.916	regulation of metabolic process
GO:1901360	0.878	organic cyclic compound metabolic process
GO:0034641	0.878	cellular nitrogen compound metabolic process
GO:0050896	0.874	response to stimulus
GO:0046483	0.870	heterocycle metabolic process
GO:0051171	0.869	regulation of nitrogen compound metabolic process
GO:0006725	0.867	cellular aromatic compound metabolic process
GO:0006139	0.864	nucleobase-containing compound metabolic process
GO:0010467	0.841	gene expression
GO:0090304	0.837	nucleic acid metabolic process
GO:0016070	0.834	RNA metabolic process
GO:0048523	0.812	negative regulation of cellular process
GO:0060255	0.809	regulation of macromolecule metabolic process
GO:0080090	0.804	regulation of primary metabolic process
GO:0051716	0.696	cellular response to stimulus
GO:0034654	0.690	nucleobase-containing compound biosynthetic process
GO:0006383	0.681	transcription by RNA polymerase III
GO:0009892	0.644	negative regulation of metabolic process
GO:0010941	0.576	regulation of cell death
GO:0048583	0.556	regulation of response to stimulus
GO:0023052	0.543	signaling
GO:0007154	0.531	cell communication
GO:0051246	0.485	regulation of protein metabolic process
GO:0031323	0.458	regulation of cellular metabolic process
GO:0009966	0.439	regulation of signal transduction
GO:0051172	0.417	negative regulation of nitrogen compound metabolic process
GO:0010605	0.414	negative regulation of macromolecule metabolic process
GO:0043067	0.413	regulation of programmed cell death
GO:0048518	0.396	positive regulation of biological process
GO:1902531	0.369	regulation of intracellular signal transduction
GO:0042981	0.363	regulation of apoptotic process
GO:1902532	0.347	negative regulation of intracellular signal transduction
GO:1901564	0.346	organonitrogen compound metabolic process
GO:0010468	0.340	regulation of gene expression
GO:2001233	0.335	regulation of apoptotic signaling pathway
GO:0006396	0.326	RNA processing
GO:0007165	0.318	signal transduction
GO:0048522	0.315	positive regulation of cellular process
GO:0019219	0.315	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.305	regulation of cellular biosynthetic process
GO:0010556	0.300	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.963	cytoplasm
GO:0032991	0.952	protein-containing complex
GO:0005829	0.925	cytosol
GO:0070013	0.919	intracellular organelle lumen
GO:0031981	0.882	nuclear lumen
GO:1990904	0.548	ribonucleoprotein complex
GO:0140513	0.518	nuclear protein-containing complex
GO:0005654	0.394	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]