StarFunc result for job id Q9Y6Y1

User Input

>input (1673 residues)
MWRAEGKWLPKTSRKSVSQSVFCGTSTYCVLNTVPPIEDDHGNSNSSHVKIFLPKKLLEC
LPKCSSLPKERHRWNTNEEIAAYLITFEKHEEWLTTSPKTRPQNGSMILYNRKKVKYRKD
GYCWKKRKDGKTTREDHMKLKVQGVECLYGCYVHSSIIPTFHRRCYWLLQNPDIVLVHYL
NVPAIEDCGKPCGPILCSINTDKKEWAKWTKEELIGQLKPMFHGIKWTCSNGNSSSGFSV
EQLVQQILDSHQTKPQPRTHNCLCTGSLGAGGSVHHKCNSAKHRIISPKVEPRTGGYGSH
SEVQHNDVSEGKHEHSHSKGSSREKRNGKVAKPVLLHQSSTEVSSTNQVEVPDTTQSSPV
SISSGLNSDPDMVDSPVVTGVSGMAVASVMGSLSQSATVFMSEVTNEAVYTMSPTAGPNH
HLLSPDASQGLVLAVSSDGHKFAFPTTGSSESLSMLPTNVSEELVLSTTLDGGRKIPETT
MNFDPDCFLNNPKQGQTYGGGGLKAEMVSSNIRHSPPGERSFSFTTVLTKEIKTEDTSFE
QQMAKEAYSSSAAAVAASSLTLTAGSSLLPSGGGLSPSTTLEQMDFSAIDSNKDYTSSFS
QTGHSPHIHQTPSPSFFLQDASKPLPVEQNTHSSLSDSGGTFVMPTVKTEASSQTSSCSG
HVETRIESTSSLHLMQFQANFQAMTAEGEVTMETSQAAEGSEVLLKSGELQACSSEHYLQ
PETNGVIRSAGGVPILPGNVVQGLYPVAQPSLGNASNMELSLDHFDISFSNQFSDLINDF
ISVEGGSSTIYGHQLVSGDSTALSQSEDGARAPFTQAEMCLPCCSPQQGSLQLSSSEGGA
STMAYMHVAEVVSAASAQGTLGMLQQSGRVFMVTDYSPEWSYPEGGVKVLITGPWQEASN
NYSCLFDQISVPASLIQPGVLRCYCPAHDTGLVTLQVAFNNQIISNSVVFEYKARALPTL
PSSQHDWLSLDDNQFRMSILERLEQMERRMAEMTGSQQHKQASGGGSSGGGSGSGNGGSQ
AQCASGTGALGSCFESRVVVVCEKMMSRACWAKSKHLIHSKTFRGMTLLHLAAAQGYATL
IQTLIKWRTKHADSIDLELEVDPLNVDHFSCTPLMWACALGHLEAAVVLYKWDRRAISIP
DSLGRLPLGIARSRGHVKLAECLEHLQRDEQAQLGQNPRIHCPASEEPSTESWMAQWHSE
AISSPEIPKGVTVIASTNPELRRPRSEPSNYYSSESHKDYPAPKKHKLNPEYFQTRQEKL
LPTALSLEEPNIRKQSPSSKQSVPETLSPSEGVRDFSRELSPPTPETAAFQASGSQPVGK
WNSKDLYIGVSTVQVTGNPKGTSVGKEAAPSQVRPREPMSVLMMANREVVNTELGSYRDS
AENEECGQPMDDIQVNMMTLAEHIIEATPDRIKQENFVPMESSGLERTDPATISSTMSWL
ASYLADADCLPSAAQIRSAYNEPLTPSSNTSLSPVGSPVSEIAFEKPNLPSAADWSEFLS
ASTSEKVENEFAQLTLSDHEQRELYEAARLVQTAFRKYKGRPLREQQEVAAAVIQRCYRK
YKQYALYKKMTQAAILIQSKFRSYYEQKKFQQSRRAAVLIQKYYRSYKKCGKRRQARRTA
VIVQQKLRSSLLTKKQDQAARKIMRFLRRCRHSPLVDHRLYKRSERIEKGQGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A891	0.252	0.251	0.000	1682	0.941	0.936	A2A891.pdb.gz	CMTA1_MOUSE Calmodulin-binding transcription activator 1 OS=Mus musculus OX=10090 GN=Camta1 PE=2 SV=1
2	AFDB:Q8BI84	0.079	0.070	2.102E-7	1930	0.128	0.111	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
3	AFDB:Q5T5U3	0.048	0.043	5.384E-7	1958	0.127	0.108	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
4	AFDB:Q8I3S3	0.075	0.069	5.384E-7	1894	0.105	0.093	Q8I3S3.pdb.gz	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1
5	AFDB:H2KYH3	0.035	0.028	1.168E-6	2476	0.133	0.090	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
6	AFDB:Q6DFV3	0.044	0.040	1.234E-6	1944	0.127	0.109	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
7	AFDB:Q8CGM2	0.040	0.037	4.921E-6	1859	0.128	0.115	Q8CGM2.pdb.gz	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1
8	AFDB:E9PFQ4	0.043	0.059	1.010E-5	1115	0.117	0.176	E9PFQ4.pdb.gz	E9PFQ4_HUMAN Pleckstrin homology like domain family B member 2 (Fragment) OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=1
9	AFDB:Q7K480	0.032	0.036	3.054E-5	1367	0.102	0.124	Q7K480.pdb.gz	MEPCE_DROME 7SK snRNA methylphosphate capping enzyme bin3 OS=Drosophila melanogaster OX=7227 GN=bin3 PE=1 SV=1
10	AFDB:Q9SZQ2	0.037	0.045	4.498E-5	1211	0.109	0.150	Q9SZQ2.pdb.gz	Q9SZQ2_ARATH AT4g29790/F27B13_30 OS=Arabidopsis thaliana OX=3702 GN=At4g29790 PE=1 SV=1
11	PDB:6vxkB	0.050	0.109	8.234E-5	747	0.011	0.024	6vxkB.pdb.gz
12	PDB:4bszB	0.066	0.516	1.432E-4	150	0.019	0.213	4bszB.pdb.gz
13	PDB:8cs9A	0.050	0.100	2.355E-4	796	0.016	0.034	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
14	PDB:2dvwA	0.058	0.305	3.106E-4	229	0.020	0.148	2dvwA.pdb.gz
15	PDB:6jd6B	0.060	0.357	1.927E-3	192	0.014	0.120	6jd6B.pdb.gz
16	PDB:1bd8A	0.061	0.572	2.037E-3	156	0.016	0.167	1bd8A.pdb.gz
17	PDB:1bu9A	0.062	0.548	2.153E-3	168	0.014	0.143	1bu9A.pdb.gz
18	PDB:3ehqA	0.051	0.411	2.405E-3	182	0.014	0.126	3ehqA.pdb.gz
19	PDB:4oauC	0.045	0.102	2.686E-3	692	0.022	0.052	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
20	PDB:7df7B	0.058	0.641	3.351E-3	119	0.013	0.185	7df7B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A891	0.0	3186	1682	0.937	0.932	CMTA1_MOUSE Calmodulin-binding transcription activator 1 OS=Mus musculus OX=10090 GN=Camta1 PE=2 SV=1
2	Q9Y6Y1	0.0	3484	1673	1.000	1.000	CMTA1_HUMAN Calmodulin-binding transcription activator 1 OS=Homo sapiens OX=9606 GN=CAMTA1 PE=1 SV=4
3	O94983	2.68e-137	459	1202	0.120	0.167	CMTA2_HUMAN Calmodulin-binding transcription activator 2 OS=Homo sapiens OX=9606 GN=CAMTA2 PE=1 SV=3
4	Q80Y50	1.74e-135	454	1208	0.122	0.169	CMTA2_MOUSE Calmodulin-binding transcription activator 2 OS=Mus musculus OX=10090 GN=Camta2 PE=2 SV=1
5	B7YZU5	2.03e-71	268	2005	0.075	0.063	B7YZU5_DROME Calmodulin-binding transcription activator, isoform B OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=1
6	A0SQK5	2.13e-71	268	2009	0.075	0.063	A0SQK5_DROME Calmodulin-binding transcription activator OS=Drosophila melanogaster OX=7227 GN=Camta PE=2 SV=1
7	E1JH18	2.19e-71	268	2004	0.075	0.063	E1JH18_DROME Calmodulin-binding transcription activator, isoform G OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=1
8	A0A0B4LF15	2.22e-71	268	1988	0.075	0.063	A0A0B4LF15_DROME Calmodulin-binding transcription activator, isoform I OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=1
9	B7YZU4	2.22e-71	268	2044	0.075	0.062	B7YZU4_DROME Calmodulin-binding transcription activator, isoform F OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=1
10	A1Z7V0	8.83e-71	266	1881	0.075	0.067	A1Z7V0_DROME Calmodulin-binding transcription activator, isoform D OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=3
11	A0A0B4LF06	1.04e-70	265	1675	0.075	0.075	A0A0B4LF06_DROME Calmodulin-binding transcription activator, isoform H OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=1
12	B7YZS4	1.05e-70	265	1842	0.075	0.068	B7YZS4_DROME Calmodulin-binding transcription activator, isoform E OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=1
13	Q95RQ6	3.51e-28	122	459	0.063	0.229	Q95RQ6_DROME LD15680p OS=Drosophila melanogaster OX=7227 GN=Camta PE=2 SV=1
14	Q9FY74	2.19e-21	104	1007	0.031	0.052	CMTA1_ARATH Calmodulin-binding transcription activator 1 OS=Arabidopsis thaliana OX=3702 GN=CAMTA1 PE=1 SV=2
15	Q6NPP4	2.73e-21	103	1050	0.030	0.049	CMTA2_ARATH Calmodulin-binding transcription activator 2 OS=Arabidopsis thaliana OX=3702 GN=CAMTA2 PE=1 SV=1
16	Q8GSA7	4.87e-21	103	1032	0.030	0.049	CMTA3_ARATH Calmodulin-binding transcription activator 3 OS=Arabidopsis thaliana OX=3702 GN=CAMTA3 PE=1 SV=1
17	H2KY84	3.40e-19	97.1	1185	0.029	0.041	CMTA1_CAEEL Calmodulin-binding transcription activator homolog 1 OS=Caenorhabditis elegans OX=6239 GN=camt-1 PE=1 SV=1
18	F4KCL4	1.16e-18	95.5	1066	0.027	0.042	F4KCL4_ARATH Ethylene induced calmodulin binding protein OS=Arabidopsis thaliana OX=3702 GN=EICBPB PE=1 SV=1
19	Q7XHR2	8.42e-18	92.4	927	0.030	0.055	CBT_ORYSJ Calmodulin-binding transcription activator CBT OS=Oryza sativa subsp. japonica OX=39947 GN=CBT PE=1 SV=1
20	Q9FYG2	1.03e-17	92.4	1016	0.034	0.056	CMTA4_ARATH Calmodulin-binding transcription activator 4 OS=Arabidopsis thaliana OX=3702 GN=CAMTA4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19188 AGRB_N	19	16.8	Adhesion GPCR B N-terminal region
2	PF00023 Ank	17	17.2	Ankyrin repeat
3	PF12796 Ank_2	5.1e-06	38.3	Ankyrin repeats (3 copies)
4	PF13606 Ank_3	0.9	21.2	Ankyrin repeat
5	PF13637 Ank_4	1.7	20.5	Ankyrin repeats (many copies)
6	PF13857 Ank_5	0.055	25.1	Ankyrin repeats (many copies)
7	PF03859 CG-1	1.9e-38	142.1	CG-1 domain
8	PF00612 IQ	0.45	21.4	IQ calmodulin-binding motif
9	PF15894 SgrT	3.6e+02	12.6	Inhibitor of glucose uptake transporter SgrT
10	PF01833 TIG	2.3e-07	42.2	IPT/TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306522

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365663	0.764	Natriuretic peptides A
2	9606.ENSP00000419465	0.744	WW domain-containing transcription regulator protein 1
3	9606.ENSP00000277570	0.729	Proline and serine rich 2
4	9606.ENSP00000314129	0.681	Transcription factor E3
5	9606.ENSP00000300452	0.668	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
6	9606.ENSP00000366221	0.639	Zinc finger protein castor homolog 1
7	9606.ENSP00000394352	0.631	Dixin
8	9606.ENSP00000364794	0.616	Isoleucine--tRNA ligase, cytoplasmic
9	9606.ENSP00000366410	0.609	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
10	9606.ENSP00000441140	0.599	Nucleolar protein 8
11	9606.ENSP00000478927	0.565	Transcriptional coactivator YAP1
12	9606.ENSP00000396976	0.562	Bromo adjacent homology domain-containing 1 protein
13	9606.ENSP00000358247	0.560	F-box and leucine rich repeat protein 4
14	9606.ENSP00000301729	0.540	Enoyl-CoA delta isomerase 1, mitochondrial
15	9606.ENSP00000333568	0.540	Serine/threonine-protein kinase D1
16	9606.ENSP00000306124	0.537	Protein kinase C epsilon type
17	9606.ENSP00000054666	0.523	Vesicle-associated membrane protein 3
18	9606.ENSP00000263934	0.523	Kinesin-like protein KIF1B
19	9606.ENSP00000262450	0.519	Chromodomain-helicase-DNA-binding protein 5
20	9606.ENSP00000344503	0.511	Transmembrane protein 201

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.998	DNA binding
GO:0043565	0.984	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048518	0.948	positive regulation of biological process
GO:0031323	0.945	regulation of cellular metabolic process
GO:0051171	0.941	regulation of nitrogen compound metabolic process
GO:0080090	0.940	regulation of primary metabolic process
GO:0060255	0.938	regulation of macromolecule metabolic process
GO:0031325	0.935	positive regulation of cellular metabolic process
GO:0010604	0.922	positive regulation of macromolecule metabolic process
GO:0051173	0.895	positive regulation of nitrogen compound metabolic process
GO:0010468	0.825	regulation of gene expression
GO:0009889	0.650	regulation of biosynthetic process
GO:0031326	0.618	regulation of cellular biosynthetic process
GO:1903506	0.608	regulation of nucleic acid-templated transcription
GO:0006355	0.590	regulation of DNA-templated transcription
GO:0048583	0.505	regulation of response to stimulus
GO:0023051	0.479	regulation of signaling
GO:0032501	0.457	multicellular organismal process
GO:0009987	0.442	cellular process
GO:0010646	0.436	regulation of cell communication
GO:0009966	0.432	regulation of signal transduction
GO:0051254	0.388	positive regulation of RNA metabolic process
GO:0019220	0.306	regulation of phosphate metabolic process
GO:0010557	0.301	positive regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0031981	0.998	nuclear lumen
GO:0005730	0.841	nucleolus
GO:0005654	0.827	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]