StarFunc result for job id Q9Y6Y8

User Input

>input (1000 residues)
MAERKPNGGSGGASTSSSGTNLLFSSSATEFSFNVPFIPVTQASASPASLLLPGEDSTDV
GEEDSFLGQTSIHTSAPQTFSYFSQVSSSSDPFGNIGQSPLTTAATSVGQSGFPKPLTAL
PFTTGSQDVSNAFSPSISKAQPGAPPSSLMGINSYLPSQPSSLPPSYFGNQPQGIPQPGY
NPYRHTPGSSRANPYIAPPQLQQCQTPGPPAHPPPSGPPVQMYQMPPGSLPPVPSSVQSP
AQQQVPARPGAPSVQVPSPFLLQNQYEPVQPHWFYCKEVEYKQLWMPFSVFDSLNLEEIY
NSVQPDPESVVLGTDGGRYDVYLYDRIRKAAYWEEEPAEVRRCTWFYKGDTDSRFIPYTE
EFSEKLEAEYKKAVTTNQWHRRLEFPSGETIVMHNPKVIVQFQPSSVPDEWGTTQDGQTR
PRVVKRGIDDNLDEIPDGEMPQVDHLVFVVHGIGPVCDLRFRSIIECVDDFRVVSLKLLR
THFKKSLDDGKVSRVEFLPVHWHSSLGGDATGVDRNIKKITLPSIGRFRHFTNETLLDIL
FYNSPTYCQTIVEKVGMEINHLHALFMSRNPDFKGGVSVAGHSLGSLILFDILSNQKDLN
LSKCPGPLAVANGVVKQLHFQEKQMPEEPKLTLDESYDLVVENKEVLTLQETLEALSLSE
YFSTFEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFVEHKAAKLKKAASEKKAVAAT
STKGQEQSAQKTKDMASLPSESNEPKRKLPVGACVSSVCVNYESFEVGAGQVSVAYNSLD
FEPEIFFALGSPIAMFLTIRGVDRIDENYSLPTCKGFFNIYHPLDPVAYRLEPMIVPDLD
LKAVLIPHHKGRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSSTQLQE
ELEKVANQIKEEEEKQVVEAEKVVESPDFSKDEDYLGKVGMLNGGRRIDYVLQEKPIESF
NEYLFALQSHLCYWESEDTALLLLKEIYRTMNISPEQPQH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NZC7	0.675	0.676	0.000	998	0.863	0.865	Q6NZC7.pdb.gz	S23IP_MOUSE SEC23-interacting protein OS=Mus musculus OX=10090 GN=Sec23ip PE=1 SV=2
2	AFDB:Q9Y6Y8	1.000	1.000	0.000	1000	1.000	1.000	Q9Y6Y8.pdb.gz	S23IP_HUMAN SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1
3	PDB:3esbA	0.083	0.328	2.106E-2	199	0.019	0.095	3esbA.pdb.gz	Solid-state structural characterization of cutinase-ECE-pincer-metal hybrids
4	PDB:5gv7A	0.049	0.124	4.657E-2	272	0.033	0.121	5gv7A.pdb.gz	Distribution of valence electrons of the flavin cofactor in NADH-cytochrome b5 reductase.
5	PDB:3dcnA	0.083	0.336	7.756E-2	195	0.017	0.087	3dcnA.pdb.gz
6	PDB:3gbsA	0.086	0.359	1.221E-1	187	0.019	0.102	3gbsA.pdb.gz
7	AFDB:Q24432	0.039	0.040	1.598E-1	972	0.116	0.119	Q24432.pdb.gz	OMB_DROME Optomotor-blind protein OS=Drosophila melanogaster OX=7227 GN=bi PE=1 SV=3
8	PDB:1vkhA	0.065	0.197	1.921E-1	261	0.026	0.100	1vkhA.pdb.gz
9	PDB:3hc7A	0.079	0.269	3.023E-1	252	0.023	0.091	3hc7A.pdb.gz
10	PDB:6sgaCp	0.049	0.270	3.023E-1	178	0.014	0.079	6sgaCp.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
11	PDB:1zq1A	0.067	0.125	5.036E-1	437	0.024	0.055	1zq1A.pdb.gz	Structural Basis for tRNA-Dependent Amidotransferase Function
12	PDB:7dblA	0.067	0.141	6.686E-1	422	0.018	0.043	7dblA.pdb.gz	Structural basis for substrate specificity of the peroxisomal acyl-CoA hydrolase MpaH' involved in mycophenolic acid biosynthesis.
13	AFDB:Q9VWK5	0.048	0.034	7.384E-1	1513	0.115	0.076	Q9VWK5.pdb.gz	Q9VWK5_DROME GH15225p OS=Drosophila melanogaster OX=7227 GN=Ulp1 PE=1 SV=1
14	PDB:2a2jA	0.035	0.117	7.488E-1	203	0.013	0.064	2a2jA.pdb.gz
15	AFDB:Q9VV52	0.047	0.043	1.038	1117	0.110	0.098	Q9VV52.pdb.gz	Q9VV52_DROME LD37257p OS=Drosophila melanogaster OX=7227 GN=RAF2 PE=1 SV=3
16	AFDB:P34333	0.045	0.029	1.162	1778	0.141	0.079	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
17	AFDB:P13709	0.053	0.031	1.230	2038	0.105	0.052	P13709.pdb.gz	FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster OX=7227 GN=fs(1)h PE=1 SV=2
18	AFDB:Q10145	0.056	0.070	1.302	738	0.087	0.118	Q10145.pdb.gz	YAS9_SCHPO Uncharacterized RNA-binding protein C3H8.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H8.09c PE=4 SV=1
19	AFDB:Q9NYV4	0.065	0.050	1.633	1490	0.104	0.070	Q9NYV4.pdb.gz	CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2
20	AFDB:Q387B8	0.034	0.030	1.829	1156	0.066	0.057	Q387B8.pdb.gz	Q387B8_TRYB2 Protein kinase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.47.0015 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94830	0.0	761	711	0.391	0.550	DDHD2_HUMAN Phospholipase DDHD2 OS=Homo sapiens OX=9606 GN=DDHD2 PE=1 SV=2
2	Q6NZC7	0.0	1620	998	0.860	0.862	S23IP_MOUSE SEC23-interacting protein OS=Mus musculus OX=10090 GN=Sec23ip PE=1 SV=2
3	Q80Y98	0.0	742	699	0.382	0.546	DDHD2_MOUSE Phospholipase DDHD2 OS=Mus musculus OX=10090 GN=Ddhd2 PE=1 SV=3
4	Q9Y6Y8	0.0	2063	1000	1.000	1.000	S23IP_HUMAN SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1
5	M9MRD9	2.57e-111	360	663	0.167	0.252	M9MRD9_DROME Phosphatidic acid phospholipase A1, isoform B OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=1 SV=1
6	Q8MQQ8	5.69e-108	367	1332	0.167	0.125	Q8MQQ8_DROME LD21041p (Fragment) OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=2 SV=1
7	X2JDJ3	2.88e-107	370	2015	0.168	0.083	X2JDJ3_DROME Phosphatidic acid phospholipase A1, isoform D OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=1 SV=1
8	Q9VLS7	3.68e-107	370	2016	0.167	0.083	Q9VLS7_DROME LD21067p OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=1 SV=1
9	H0YF17	1.29e-78	257	213	0.132	0.620	H0YF17_HUMAN DDHD domain containing 2 (Fragment) OS=Homo sapiens OX=9606 GN=DDHD2 PE=1 SV=1
10	E9PK57	2.38e-46	165	162	0.092	0.568	E9PK57_HUMAN DDHD domain containing 2 OS=Homo sapiens OX=9606 GN=DDHD2 PE=1 SV=1
11	Q8W5R2	5.02e-31	134	933	0.101	0.108	SHGR2_ARATH Phospholipase SGR2 OS=Arabidopsis thaliana OX=3702 GN=SGR2 PE=1 SV=1
12	Q80YA3	1.14e-24	112	547	0.075	0.137	DDHD1_MOUSE Phospholipase DDHD1 OS=Mus musculus OX=10090 GN=Ddhd1 PE=1 SV=1
13	Q8NEL9	4.72e-24	111	900	0.125	0.139	DDHD1_HUMAN Phospholipase DDHD1 OS=Homo sapiens OX=9606 GN=DDHD1 PE=1 SV=2
14	G5EEM9	4.67e-23	108	840	0.116	0.138	PLA1_CAEEL Intracellular phospholipase A1 OS=Caenorhabditis elegans OX=6239 GN=ipla-1 PE=1 SV=1
15	Q12204	1.16e-18	94.0	715	0.059	0.083	YOR22_YEAST Probable phospholipase YOR022C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR022C PE=1 SV=1
16	P87109	5.17e-16	85.5	757	0.067	0.089	YDK2_SCHPO Probable phospholipase C20G8.02, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC20G8.02 PE=3 SV=1
17	O00562	1.08e-08	62.0	1244	0.067	0.054	PITM1_HUMAN Membrane-associated phosphatidylinositol transfer protein 1 OS=Homo sapiens OX=9606 GN=PITPNM1 PE=1 SV=4
18	Q7LKZ6	2.42e-08	60.5	669	0.064	0.096	YJMD_SCHPO Probable phospholipase C1020.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1020.13c PE=3 SV=1
19	Q5U2N3	7.95e-08	58.9	1242	0.055	0.044	PITM1_RAT Membrane-associated phosphatidylinositol transfer protein 1 OS=Rattus norvegicus OX=10116 GN=Pitpnm1 PE=1 SV=1
20	Q9SFU7	1.45e-07	55.5	203	0.024	0.118	Q9SFU7_ARATH AT3g07170/T1B9_17 OS=Arabidopsis thaliana OX=3702 GN=IRP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02862 DDHD	1.5e-55	200.6	DDHD domain
2	PF09597 IGR	1.7e+02	13.7	IGR protein motif
3	PF00536 SAM_1	1.2e-10	53.0	SAM domain (Sterile alpha motif)
4	PF07647 SAM_2	0.42	22.1	SAM domain (Sterile alpha motif)
5	PF04048 Sec8_exocyst	84	14.5	Sec8 exocyst complex component specific domain
6	PF02825 WWE	2.1e-05	36.3	WWE domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358071

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378721	0.957	Protein transport protein Sec31A
2	9606.ENSP00000444850	0.888	General vesicular transport factor p115
3	9606.ENSP00000373312	0.876	Protein SEC13 homolog
4	9606.ENSP00000306881	0.874	Protein transport protein Sec23A
5	9606.ENSP00000428564	0.813	Protein transport protein Sec24B
6	9606.ENSP00000325827	0.800	Protein transport protein Sec16A
7	9606.ENSP00000381823	0.796	Protein transport protein Sec24A
8	9606.ENSP00000387286	0.792	Ras-related protein Rab-1A
9	9606.ENSP00000442573	0.768	Zinc finger protein 668
10	9606.ENSP00000385432	0.756	GTP-binding protein SAR1b
11	9606.ENSP00000291574	0.755	Trafficking protein particle complex subunit 10
12	9606.ENSP00000463393	0.750	Vesicle-trafficking protein SEC22b
13	9606.ENSP00000373979	0.747	Trafficking protein particle complex subunit 9
14	9606.ENSP00000386651	0.730	Multiple coagulation factor deficiency protein 2
15	9606.ENSP00000262225	0.719	Transmembrane emp24 domain-containing protein 2
16	9606.ENSP00000338844	0.715	Protein transport protein Sec23B
17	9606.ENSP00000343405	0.715	Protein transport protein Sec24C
18	9606.ENSP00000280551	0.709	Protein transport protein Sec24D
19	9606.ENSP00000265000	0.707	N-acetylgalactosaminyltransferase 7
20	9606.ENSP00000251047	0.701	Protein ERGIC-53

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0003723	0.995	RNA binding
GO:0016298	0.579	lipase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0006810	0.986	transport
GO:0010256	0.978	endomembrane system organization
GO:0051641	0.957	cellular localization
GO:0006996	0.944	organelle organization
GO:0046907	0.896	intracellular transport
GO:0033036	0.699	macromolecule localization
GO:0071702	0.603	organic substance transport
GO:0071705	0.594	nitrogen compound transport
GO:0065007	0.394	biological regulation
GO:0007030	0.394	Golgi organization
GO:0050789	0.360	regulation of biological process
GO:0045184	0.348	establishment of protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0031982	0.997	vesicle
GO:0031410	0.991	cytoplasmic vesicle
GO:0005794	0.990	Golgi apparatus
GO:0030135	0.980	coated vesicle
GO:0016020	0.959	membrane
GO:0005783	0.946	endoplasmic reticulum
GO:0005793	0.885	endoplasmic reticulum-Golgi intermediate compartment
GO:0031090	0.880	organelle membrane
GO:0030134	0.842	COPII-coated ER to Golgi transport vesicle
GO:0070013	0.675	intracellular organelle lumen
GO:0005634	0.649	nucleus
GO:0098588	0.579	bounding membrane of organelle
GO:0071944	0.504	cell periphery
GO:0031981	0.417	nuclear lumen
GO:0005654	0.407	nucleoplasm
GO:0032991	0.326	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.579	Acting on ester bonds.

[back to server]