StarFunc result for job id U3KPV4

User Input

>input (340 residues)
MALKEGLRAWKRIFWRQILLTLGLLGLFLYGLPKFRHLEALIPMGVCPSATMSQLRDNFT
GALRPWARPEVLTCTPWGAPIIWDGSFDPDVAKQEARQQNLTIGLTIFAVGRYLEKYLER
FLETAEQHFMAGQSVMYYVFTELPGAVPRVALGPGRRLPVERVARERRWQDVSMARMRTL
HAALGGLPGREAHFMFCMDVDQHFSGTFGPEALAESVAQLHSWHYHWPSWLLPFERDAHS
AAAMAWGQGDFYNHAAVFGGSVAALRGLTAHCAGGLDWDRARGLEARWHDESHLNKFFWL
HKPAKVLSPEFCWSPDIGPRAEIRRPRLLWAPKGYRLLRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A4Z3	0.917	0.919	3.968E-60	339	0.694	0.696	A0A4Z3.pdb.gz	A3LT2_RAT Alpha-1,3-galactosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=A3galt2 PE=1 SV=1
2	AFDB:Q3V1N9	0.913	0.839	2.334E-58	370	0.676	0.622	Q3V1N9.pdb.gz	A3LT2_MOUSE Alpha-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=A3galt2 PE=2 SV=1
3	AFDB:Q3L7M0	0.814	0.747	1.320E-39	371	0.394	0.361	Q3L7M0.pdb.gz	GGTA1_RAT N-acetyllactosaminide alpha-1,3-galactosyltransferase OS=Rattus norvegicus OX=10116 GN=Ggta1 PE=1 SV=2
4	AFDB:B0B1U2	0.796	0.765	9.984E-37	354	0.406	0.390	B0B1U2.pdb.gz	B0B1U2_HUMAN ABO glycosyltransferase OS=Homo sapiens OX=9606 GN=ABO PE=1 SV=1
5	AFDB:Q8CFC4	0.796	0.810	1.061E-36	334	0.400	0.407	Q8CFC4.pdb.gz	BGAT2_RAT Histo-blood group ABO system transferase 2 OS=Rattus norvegicus OX=10116 GN=Abo2 PE=1 SV=1
6	AFDB:Q9ET32	0.796	0.778	3.581E-36	348	0.356	0.348	Q9ET32.pdb.gz	BGAT1_RAT Histo-blood group ABO system transferase 1 OS=Rattus norvegicus OX=10116 GN=Abo PE=1 SV=1
7	AFDB:Q95158	0.784	0.768	1.966E-35	347	0.379	0.372	Q95158.pdb.gz	GBGT1_CANLF Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Canis lupus familiaris OX=9615 GN=GBGT1 PE=1 SV=1
8	AFDB:Q8VI38	0.787	0.772	2.220E-35	347	0.376	0.369	Q8VI38.pdb.gz	GBGT1_MOUSE Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Gbgt1 PE=1 SV=2
9	AFDB:P38649	0.795	0.815	6.633E-35	332	0.356	0.364	P38649.pdb.gz	BGAT_MOUSE Histo-blood group ABO system transferase OS=Mus musculus OX=10090 GN=Abo PE=1 SV=2
10	AFDB:Q8N5D6	0.783	0.767	6.633E-35	347	0.326	0.320	Q8N5D6.pdb.gz	GBGT1_HUMAN Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=GBGT1 PE=1 SV=2
11	PDB:4y63A	0.772	0.930	1.155E-34	282	0.356	0.429	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
12	PDB:6fxrA	0.379	0.201	9.619E-6	700	0.115	0.056	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
13	PDB:8cvzI	0.363	0.444	1.086E-5	267	0.082	0.105	8cvzI.pdb.gz
14	PDB:1ll0B	0.379	0.467	2.121E-5	267	0.085	0.109	1ll0B.pdb.gz
15	PDB:7jhiC	0.351	0.359	1.164E-4	331	0.082	0.085	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
16	PDB:7msnA	0.218	0.183	9.205E-4	417	0.062	0.050	7msnA.pdb.gz	Structural and mechanistic investigations of protein S-glycosyltransferases.
17	PDB:6b5eB	0.305	0.353	2.029E-3	286	0.082	0.098	6b5eB.pdb.gz	The structure of glucose-1-phosphate thymidylyltransferase from Mycobacterium tuberculosis reveals the location of an essential magnesium ion in the RmlA-type enzymes.
18	PDB:7d72A	0.296	0.259	3.728E-3	407	0.071	0.059	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
19	PDB:7f66J	0.293	0.190	4.210E-3	591	0.088	0.051	7f66J.pdb.gz
20	PDB:1mc3A	0.314	0.359	7.278E-3	291	0.059	0.069	1mc3A.pdb.gz	Crystal Structure of Escherichia coli Glucose-1-Phosphate Thymidylyltransferase (RffH) Complexed with dTTP and Mg2+

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A4Z3	3.67e-171	481	339	0.694	0.696	A3LT2_RAT Alpha-1,3-galactosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=A3galt2 PE=1 SV=1
2	Q3V1N9	4.90e-165	466	370	0.676	0.622	A3LT2_MOUSE Alpha-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=A3galt2 PE=2 SV=1
3	Q3L7M0	2.47e-89	274	371	0.374	0.342	GGTA1_RAT N-acetyllactosaminide alpha-1,3-galactosyltransferase OS=Rattus norvegicus OX=10116 GN=Ggta1 PE=1 SV=2
4	Q8CFC4	3.10e-76	239	334	0.371	0.377	BGAT2_RAT Histo-blood group ABO system transferase 2 OS=Rattus norvegicus OX=10116 GN=Abo2 PE=1 SV=1
5	B0B1U2	3.79e-75	237	354	0.365	0.350	B0B1U2_HUMAN ABO glycosyltransferase OS=Homo sapiens OX=9606 GN=ABO PE=1 SV=1
6	P16442	4.59e-74	234	354	0.362	0.347	BGAT_HUMAN Histo-blood group ABO system transferase OS=Homo sapiens OX=9606 GN=ABO PE=1 SV=2
7	P38649	9.45e-74	233	332	0.362	0.370	BGAT_MOUSE Histo-blood group ABO system transferase OS=Mus musculus OX=10090 GN=Abo PE=1 SV=2
8	Q9ET32	5.53e-73	231	348	0.356	0.348	BGAT1_RAT Histo-blood group ABO system transferase 1 OS=Rattus norvegicus OX=10116 GN=Abo PE=1 SV=1
9	Q95158	4.91e-72	229	347	0.329	0.323	GBGT1_CANLF Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Canis lupus familiaris OX=9615 GN=GBGT1 PE=1 SV=1
10	Q8VI38	3.32e-70	224	347	0.341	0.334	GBGT1_MOUSE Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Gbgt1 PE=1 SV=2
11	Q8N5D6	2.44e-65	211	347	0.315	0.308	GBGT1_HUMAN Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=GBGT1 PE=1 SV=2
12	P40445	1.2	33.5	542	0.076	0.048	YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YIL166C PE=1 SV=1
13	O88277	1.3	33.5	4351	0.065	0.005	FAT2_RAT Protocadherin Fat 2 OS=Rattus norvegicus OX=10116 GN=Fat2 PE=1 SV=1
14	Q9LPF6	1.6	32.7	379	0.062	0.055	PUP11_ARATH Probable purine permease 11 OS=Arabidopsis thaliana OX=3702 GN=PUP11 PE=1 SV=1
15	P15539	5.3	31.6	500	0.097	0.066	C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus OX=10090 GN=Cyp11b2 PE=2 SV=3
16	A0A1D8PJN6	8.6	30.8	1447	0.044	0.010	A0A1D8PJN6_CANAL Kre5p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KRE5 PE=3 SV=1
17	P30099	8.7	30.8	510	0.062	0.041	C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11b2 PE=1 SV=1
18	P30100	9.1	30.8	500	0.062	0.042	C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11b3 PE=1 SV=1
19	Q09671	9.9	30.4	392	0.050	0.043	OYEB_SCHPO Putative NADPH dehydrogenase C5H10.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.10 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03414 Glyco_transf_6	3.2e-96	333.4	Glycosyltransferase family 6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000475261

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376532	0.943	UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
2	9606.ENSP00000306459	0.835	Beta-1,4-galactosyltransferase 6
3	9606.ENSP00000306920	0.803	Beta-galactosidase
4	9606.ENSP00000357153	0.721	Antigen-presenting glycoprotein CD1d
5	9606.ENSP00000300404	0.718	Beta-1,4 N-acetylgalactosaminyltransferase 2
6	9606.ENSP00000384794	0.691	Lactosylceramide 4-alpha-galactosyltransferase
7	9606.ENSP00000376456	0.621	Beta-1,3-galactosyltransferase 1
8	9606.ENSP00000341562	0.602	Beta-1,4 N-acetylgalactosaminyltransferase 1
9	9606.ENSP00000360850	0.590	Mitochondrial ribosomal protein S2
10	9606.ENSP00000218516	0.537	Galactosidase alpha
11	9606.ENSP00000363397	0.517	Ceramide glucosyltransferase
12	9606.ENSP00000385735	0.512	Galactosylceramide sulfotransferase
13	9606.ENSP00000316173	0.505	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008194	1.000	UDP-glycosyltransferase activity
GO:0008378	1.000	galactosyltransferase activity
GO:0035250	0.764	UDP-galactosyltransferase activity
GO:0008376	0.613	acetylgalactosaminyltransferase activity
GO:0001962	0.575	alpha-1,3-galactosyltransferase activity
GO:0005488	0.570	binding
GO:0005515	0.435	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0009058	0.995	biosynthetic process
GO:1901135	0.995	carbohydrate derivative metabolic process
GO:0006643	0.995	membrane lipid metabolic process
GO:1901137	0.991	carbohydrate derivative biosynthetic process
GO:1903509	0.990	liposaccharide metabolic process
GO:0006665	0.986	sphingolipid metabolic process
GO:0030148	0.979	sphingolipid biosynthetic process
GO:0006664	0.975	glycolipid metabolic process
GO:0009247	0.948	glycolipid biosynthetic process
GO:0006687	0.944	glycosphingolipid metabolic process
GO:0006688	0.933	glycosphingolipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.998	Golgi apparatus
GO:0031982	0.972	vesicle
GO:0016020	0.962	membrane
GO:0031090	0.877	organelle membrane
GO:0098588	0.702	bounding membrane of organelle
GO:0000139	0.694	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]