StarFunc result for job id W6CW81

User Input

>input (113 residues)
MESKYKEILLLTSLDNITDEELDRFKCFLPDEFNIATGKLHTLNSTSSQLDLKRWHGVCS
EEDRIFQKLNYMLVAKCLREEQETGICGSPSSARSVSQSRLGLSFHGISGNAC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:W6CW81	1.000	1.000	7.649E-18	113	1.000	1.000	W6CW81.pdb.gz	PYDC5_HUMAN Pyrin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=PYDC5 PE=1 SV=1
2	PDB:2kn6A	0.317	0.218	1.369	195	0.230	0.133	2kn6A.pdb.gz
3	PDB:3gtyX	0.223	0.073	2.856	412	0.088	0.024	3gtyX.pdb.gz
4	PDB:2jqtA	0.249	0.445	4.875	57	0.044	0.088	2jqtA.pdb.gz
5	PDB:5o8xA	0.193	0.093	4.875	304	0.071	0.026	5o8xA.pdb.gz	X-ray Structure of Catenated Lytic Transglycosylase SltB1.
6	PDB:5k2zB	0.205	0.093	5.958	278	0.044	0.018	5k2zB.pdb.gz	Structural definition of the lysine swing in Arabidopsis thaliana PDX1: Intermediate channeling facilitating vitamin B6 biosynthesis.
7	PDB:6hxgA	0.207	0.098	5.958	264	0.044	0.019	6hxgA.pdb.gz
8	PDB:7z0oG	0.181	0.219	5.958	84	0.115	0.155	7z0oG.pdb.gz	Mechanism of RNA polymerase I selection by transcription factor UAF.
9	PDB:5eq6A	0.237	0.103	6.370	357	0.044	0.014	5eq6A.pdb.gz	PilN Binding Modulates the Structure and Binding Partners of the Pseudomonas aeruginosa Type IVa Pilus Protein PilM.
10	PDB:3al5C	0.194	0.093	6.811	284	0.071	0.028	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
11	PDB:5h7nB	0.286	0.094	6.811	460	0.124	0.030	5h7nB.pdb.gz	Design of an expression system to enhance MBP-mediated crystallization
12	AFDB:P06602	0.141	0.060	7.191	376	0.133	0.040	P06602.pdb.gz	EVE_DROME Segmentation protein even-skipped OS=Drosophila melanogaster OX=7227 GN=eve PE=1 SV=3
13	AFDB:A0A0B4LHC9	0.199	0.074	8.220	330	0.177	0.061	A0A0B4LHC9.pdb.gz	A0A0B4LHC9_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5554 PE=1 SV=1
14	AFDB:Q9M276	0.210	0.113	8.220	235	0.150	0.072	Q9M276.pdb.gz	ATB12_ARATH Homeobox-leucine zipper protein ATHB-12 OS=Arabidopsis thaliana OX=3702 GN=ATHB-12 PE=1 SV=1
15	AFDB:O43763	0.229	0.103	8.788	284	0.115	0.046	O43763.pdb.gz	TLX2_HUMAN T-cell leukemia homeobox protein 2 OS=Homo sapiens OX=9606 GN=TLX2 PE=1 SV=2
16	AFDB:Q54G14	0.213	0.032	8.788	1081	0.159	0.017	Q54G14.pdb.gz	Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0290685 PE=2 SV=2
17	AFDB:Q9H2Z4	0.210	0.069	9.396	354	0.142	0.045	Q9H2Z4.pdb.gz	NKX24_HUMAN Homeobox protein Nkx-2.4 OS=Homo sapiens OX=9606 GN=NKX2-4 PE=1 SV=3
18	AFDB:Q9QX99	0.247	0.089	9.396	333	0.115	0.039	Q9QX99.pdb.gz	Q9QX99_MOUSE T-cell leukemia, homeobox 1 OS=Mus musculus OX=10090 GN=Tlx1 PE=1 SV=1
19	AFDB:Q9VI24	0.206	0.072	9.396	388	0.124	0.036	Q9VI24.pdb.gz	Q9VI24_DROME LD25151p OS=Drosophila melanogaster OX=7227 GN=Zif PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	W6CW81	7.75e-81	234	113	1.000	1.000	PYDC5_HUMAN Pyrin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=PYDC5 PE=1 SV=1
2	O14862	4.23e-28	106	343	0.513	0.169	AIM2_HUMAN Interferon-inducible protein AIM2 OS=Homo sapiens OX=9606 GN=AIM2 PE=1 SV=1
3	Q91VJ1	3.98e-12	63.2	354	0.336	0.107	AIM2_MOUSE Interferon-inducible protein AIM2 OS=Mus musculus OX=10090 GN=Aim2 PE=1 SV=2
4	Q1ZXF7	1.3	30.4	356	0.186	0.059	GMDS_DICDI GDP-mannose 4,6 dehydratase OS=Dictyostelium discoideum OX=44689 GN=gmd PE=1 SV=1
5	Q9EQY0	2.1	29.6	977	0.159	0.018	ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus OX=10090 GN=Ern1 PE=1 SV=1
6	A0A8I6AJE4	2.2	29.6	927	0.159	0.019	A0A8I6AJE4_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Ern1 PE=4 SV=1
7	G5EC05	3.7	29.3	1570	0.177	0.013	G5EC05_CAEEL Cnd1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=evl-14 PE=1 SV=1
8	O75460	5.6	28.5	977	0.159	0.018	ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens OX=9606 GN=ERN1 PE=1 SV=2
9	F1LSY7	5.8	28.5	965	0.159	0.019	F1LSY7_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Ern1 PE=4 SV=2
10	O80898	5.8	28.5	757	0.159	0.024	CSLB1_ARATH Cellulose synthase-like protein B1 OS=Arabidopsis thaliana OX=3702 GN=CSLB1 PE=2 SV=2
11	A0A0G2K2H4	6.1	28.5	977	0.159	0.018	A0A0G2K2H4_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Ern1 PE=2 SV=1
12	O26057	6.6	28.1	457	0.257	0.063	DNAA_HELPY Chromosomal replication initiator protein DnaA OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=dnaA PE=1 SV=1
13	Q9Z2V5	6.6	28.5	1149	0.177	0.017	HDAC6_MOUSE Histone deacetylase 6 OS=Mus musculus OX=10090 GN=Hdac6 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02758 PYRIN	3	19.4	PAAD/DAPIN/Pyrin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008972710.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003821026.1	0.800	Absent in melanoma 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.542	identical protein binding
GO:1901363	0.370	heterocyclic compound binding
GO:0097159	0.370	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0043254	0.970	regulation of protein-containing complex assembly
GO:0051129	0.966	negative regulation of cellular component organization
GO:0009615	0.952	response to virus
GO:0031333	0.935	negative regulation of protein-containing complex assembly
GO:0098586	0.910	cellular response to virus
GO:0034097	0.909	response to cytokine
GO:0035456	0.899	response to interferon-beta
GO:0009987	0.782	cellular process
GO:0071345	0.725	cellular response to cytokine stimulus
GO:0035458	0.300	cellular response to interferon-beta

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.997	nucleus
GO:0005829	0.989	cytosol
GO:0032991	0.980	protein-containing complex
GO:0031981	0.977	nuclear lumen
GO:0005654	0.832	nucleoplasm
GO:0097169	0.321	AIM2 inflammasome complex
GO:0005739	0.309	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]