********************************************************************
* US-align (Version 20211003) *
* Universal Structure Alignment of Proteins and Nucleic Acids *
* References: C Zhang, M Shine, AM Pyle, Y Zhang. (2022) Submitted.*
* Please email comments and suggestions to yangzhanglab@umich.edu *
********************************************************************
Name of Structure_1: US938614936A.pdb:A (to be superimposed onto Structure_2)
Name of Structure_2: US938614936B.pdb:A
Length of Structure_1: 154 residues
Length of Structure_2: 146 residues
Aligned length= 143, RMSD= 1.83, Seq_ID=n_identical/n_aligned= 0.245
TM-score= 0.81453 (normalized by length of Structure_1: L=154, d0=4.62)
TM-score= 0.85377 (normalized by length of Structure_2: L=146, d0=4.50)
(You should use TM-score normalized by length of the reference structure)
(":" denotes residue pairs of d < 5.0 Angstrom, "." denotes other aligned residues)
MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK--G-HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
:::::::::::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::: : :::::::::::::: ::::::::::::::::::::::::: :::::::::::::::::::::: : ::
-SLSAAEADLAGKSWAPVFANKNANGLDFLVALFEKFPDSANFFADFKGKS-VADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHV-GFGVGSAQFENVRSMFPGFVASVAA--PPAGADAAWTKLFGLIIDALKA-A-----GA
#Total CPU time is 0.03 seconds
|
(water of Structure_1 and Structure_2 in blue and red, respectively; non-water ligand of Structure_1 and Structure_2 in cyan and pink, respectively). |