1m2d/1/1:A/1:B

Sequences

>1m2d-a1-m1-cA (length=101) [Search sequence]

FKHVFVCVQDRPPGHPQGSCAQRGSREVFQAFMEKIQTDPQLFMTTVITPTGCMNASMMG PVVVVYPDGVWYGQVKPEDVDEIVEKHLKGGEPVERLVISK

>1m2d-a1-m1-cB (length=101) [Search sequence]

FKHVFVCVQDRPPGHPQGSCAQRGSREVFQAFMEKIQTDPQLFMTTVITPTGCMNASMMG PVVVVYPDGVWYGQVKPEDVDEIVEKHLKGGEPVERLVISK

Structure information

PDB ID	1m2d (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure at 1.05 Angstroms resolution of the Cys59Ser variant of the thioredoxin-like [2Fe-2S] ferredoxin from Aquifex aeolicus
Assembly ID	1
Resolution	1.05Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	38
Sequence identity between the two chains	1.0
PubMed citation	12089152

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O66511	O66511
Species	63363 (Aquifex aeolicus)	63363 (Aquifex aeolicus)
Function annotation	BioLiP:1m2dA	BioLiP:1m2dB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1m2d-a1-m1-cA_1m2d-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1m2d-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1f37/1/1:A/1:B 1f37/2/1:A/1:B 1f37/2/2:A/2:B 1m2a/1/1:B/1:A 1m2b/1/1:A/1:B