1n9l/3/1:A/3:A

Sequences
>1n9l-a3-m1-cA (length=109) [Search sequence]
GLRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDA
IKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS
>1n9l-a3-m3-cA (length=109) [Search sequence]
GLRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDA
IKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS
Structure information
PDB ID 1n9l (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Phot-LOV1 domain from Chlamydomonas reinhardtii in the dark state.
Assembly ID 3
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 60
Sequence identity between the two chains 1.0
PubMed citation 12668455
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID A A
UniProt accession Q8LPD9 Q8LPD9
Species 3055 (Chlamydomonas reinhardtii) 3055 (Chlamydomonas reinhardtii)
Function annotation BioLiP:1n9lA BioLiP:1n9lA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1n9l-a3-m1-cA_1n9l-a3-m3-cA.pdb.gz
Full biological assembly
Download: 1n9l-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1n9l/2/1:A/2:A 1n9o/2/1:A/2:A
  • [Back to Home]