1nei/1/1:A/1:B

Sequences

>1nei-a1-m1-cA (length=60) [Search sequence]

MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

>1nei-a1-m1-cB (length=60) [Search sequence]

MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Structure information

PDB ID	1nei (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Solution NMR Structure of Protein yoaG from Escherichia coli. Ontario Centre for Structural Proteomics Target EC0264_1_60; Northeast Structural Genomics Consortium Target ET94.
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	104
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P64496	P64496
Species	562 (Escherichia coli)	562 (Escherichia coli)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1nei-a1-m1-cA_1nei-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1nei-assembly1.cif.gz