1nxt/1/1:A/2:A

Sequences

>1nxt-a1-m1-cA (length=115) [Search sequence]

KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILLMLPDGLEVA KTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS

>1nxt-a1-m2-cA (length=115) [Search sequence]

KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILLMLPDGLEVA KTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS

Structure information

PDB ID	1nxt (database links: RCSB PDB PDBe PDBj PDBsum)
Title	MicArec pH 4.0
Assembly ID	1
Resolution	2.34Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	10
Sequence identity between the two chains	1.0
PubMed citation	15090529

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	A
UniProt accession	A0A0H2UQ68	A0A0H2UQ68
Species	170187 (Streptococcus pneumoniae TIGR4)	170187 (Streptococcus pneumoniae TIGR4)
Function annotation	BioLiP:1nxtA	BioLiP:1nxtA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 1nxt-a1-m1-cA_1nxt-a1-m2-cA.pdb.gz

Full biological assembly Download: 1nxt-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1nxo/1/1:A/2:A 1nxp/1/1:A/2:A 1nxx/1/1:A/2:A 2a9r/1/1:A/2:A
Other dimers with similar sequences but different poses	1nxw/1/1:A/2:A 1nxs/1/1:A/2:A