1p65/1/1:A/1:B

Sequences

>1p65-a1-m1-cA (length=57) [Search sequence]

DVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVT

>1p65-a1-m1-cB (length=57) [Search sequence]

DVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVT

Structure information

PDB ID	1p65 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the nucleocapsid protein of porcine reproductive and respiratory syndrome virus (PRRSV)
Assembly ID	1
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	93
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q9YJI1	Q9YJI1
Species	28344 (Porcine reproductive and respiratory syndrome virus)	28344 (Porcine reproductive and respiratory syndrome virus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1p65-a1-m1-cA_1p65-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1p65-assembly1.cif.gz