1q3p/2/2:A/2:B

Sequences

>1q3p-a2-m2-cA (length=98) [Search sequence]

DYIIKEKTVLLQKKDSEGFGFVLRGAIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGD FLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR

>1q3p-a2-m2-cB (length=103) [Search sequence]

GSDYIIKEKTVLLQKKDSEGFGFVLRGAIEEFTPTPAFPALQYLESVDEGGVAWRAGLRM GDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPD

Structure information

PDB ID	1q3p (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization
Assembly ID	2
Resolution	2.25Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	45
Sequence identity between the two chains	1.0
PubMed citation	12954649

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	B
UniProt accession	Q9WV48	Q9WV48
Species	10116 (Rattus norvegicus)	10116 (Rattus norvegicus)
Function annotation	BioLiP:1q3pA	BioLiP:1q3pB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1q3p-a2-m2-cA_1q3p-a2-m2-cB.pdb.gz

Full biological assembly Download: 1q3p-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1q3p/1/1:A/1:B 1q3p/2/1:A/1:B 7a00/3/1:B/1:A