1q3p/2/2:A/2:B

Sequences
>1q3p-a2-m2-cA (length=98) [Search sequence]
DYIIKEKTVLLQKKDSEGFGFVLRGAIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGD
FLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR
>1q3p-a2-m2-cB (length=103) [Search sequence]
GSDYIIKEKTVLLQKKDSEGFGFVLRGAIEEFTPTPAFPALQYLESVDEGGVAWRAGLRM
GDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPD
Structure information
PDB ID 1q3p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization
Assembly ID 2
Resolution 2.25Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 45
Sequence identity between the two chains 1.0
PubMed citation 12954649
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession Q9WV48 Q9WV48
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
Function annotation BioLiP:1q3pA BioLiP:1q3pB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1q3p-a2-m2-cA_1q3p-a2-m2-cB.pdb.gz
Full biological assembly
Download: 1q3p-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1q3p/1/1:A/1:B 1q3p/2/1:A/1:B 7a00/3/1:B/1:A

[Back to Home]