1r8h/7/1:C/1:D

Sequences

>1r8h-a7-m1-cC (length=83) [Search sequence]

SSATPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKHAIVTVTYHSEEQRQQ FLNVVKIPPTIRHKLGFMSMHLL

>1r8h-a7-m1-cD (length=87) [Search sequence]

SSATPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHKHAIVTVTYHSEE QRQQFLNVVKIPPTIRHKLGFMSMHLL

Structure information

PDB ID	1r8h (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Comparison of the structure and DNA binding properties of the E2 proteins from an oncogenic and a non-oncogenic human papillomavirus
Assembly ID	7
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	70
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q84294	Q84294
Species	37122 (Human papillomavirus type 6a)	37122 (Human papillomavirus type 6a)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1r8h-a7-m1-cC_1r8h-a7-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1r8h-assembly7.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1r8h/4/1:A/1:B 1r8h/4/1:C/1:D 1r8h/4/1:F/1:E 1r8h/5/1:B/1:A 1r8h/6/1:F/1:E 2ayb/1/1:B/1:A 2aye/1/1:A/1:B 2aye/2/1:D/1:C 2aye/3/1:F/1:E 2aye/4/1:A/1:B 2aye/4/2:F/2:E 2aye/4/3:D/3:C 2ayg/1/1:B/1:A
Other dimers with similar sequences but different poses	1r8h/4/1:B/1:E 1r8h/1/1:D/1:A 1r8h/2/1:E/1:B 1r8h/3/1:F/1:C 1r8h/4/1:D/1:A 1r8h/4/1:F/1:C 2aye/4/1:A/2:E 2aye/4/2:F/3:C 2aye/4/3:D/1:B