1td0/3/4:C/5:C

Sequences
>1td0-a3-m4-cC (length=101) [Search sequence]
VRIFAGNDPAHTATGSSGISSPTPALTPLMLDEATGKLVVWDGQKAGSAVGILVLPLEGT
ETALTYYKSGTFATEAIHWPESVDEHKKANAFAGSALSHAA
>1td0-a3-m5-cC (length=101) [Search sequence]
VRIFAGNDPAHTATGSSGISSPTPALTPLMLDEATGKLVVWDGQKAGSAVGILVLPLEGT
ETALTYYKSGTFATEAIHWPESVDEHKKANAFAGSALSHAA
Structure information
PDB ID 1td0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Viral capsid protein SHP at pH 5.5
Assembly ID 3
Resolution 1.95Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 58
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 5
Chain ID C C
UniProt accession P36275 P36275
Species 10711 (Enterobacteria phage P21) 10711 (Enterobacteria phage P21)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1td0-a3-m4-cC_1td0-a3-m5-cC.pdb.gz
Full biological assembly
Download: 1td0-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1td0/1/1:A/2:A 1td0/1/1:A/3:A 1td0/1/2:A/3:A 1td0/2/1:B/4:B 1td0/2/1:B/5:B 1td0/2/4:B/5:B 1td0/3/1:C/4:C 1td0/3/1:C/5:C 1td0/4/1:D/6:D 1td0/4/1:D/7:D 1td0/4/6:D/7:D 1td3/1/1:A/1:B 1td3/1/1:A/1:C 1td3/1/1:B/1:C 1td4/1/1:A/2:A 1td4/1/1:A/3:A 1td4/1/2:A/3:A

[Back to Home]