1tlu/1/1:A/1:B

Sequences

>1tlu-a1-m1-cA (length=117) [Search sequence]

KSLGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVIS ESHLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRYDEI

>1tlu-a1-m1-cB (length=117) [Search sequence]

KSLGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVIS ESHLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRYDEI

Structure information

PDB ID	1tlu (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Thermotoga maritima S-adenosylmethionine decarboxylase
Assembly ID	1
Resolution	1.55Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	108
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q9WZC3	Q9WZC3
Species	2336 (Thermotoga maritima)	2336 (Thermotoga maritima)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1tlu-a1-m1-cA_1tlu-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1tlu-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1tmi/1/1:A/1:B 1vr7/1/1:B/1:A 3iwb/1/1:A/1:C 3iwc/1/1:C/1:A 3iwd/1/1:A/1:C
Other dimers with similar sequences but different poses	3iwd/1/1:B/1:D 3iwb/1/1:B/1:D 3iwc/1/1:B/1:D