1ufi/3/1:D/1:C

Sequences

>1ufi-a3-m1-cD (length=46) [Search sequence]

HMPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTR

>1ufi-a3-m1-cC (length=48) [Search sequence]

SHMPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRK

Structure information

PDB ID	1ufi (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the dimerization domain of human CENP-B
Assembly ID	3
Resolution	1.65Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	85
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	P07199	P07199
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1ufi-a3-m1-cD_1ufi-a3-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1ufi-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1ufi/1/1:B/1:A 1ufi/2/1:D/1:C 1ufi/3/1:B/1:A