1ufl/2/2:C/1:A

Sequences

>1ufl-a2-m2-cC (length=99) [Search sequence]

MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGTTVKMELHEKVRLEIGVSEPFV KPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDE

>1ufl-a2-m1-cA (length=108) [Search sequence]

MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVR LEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED

Structure information

PDB ID	1ufl (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of TT1020 from Thermus thermophilus HB8
Assembly ID	2
Resolution	2.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	27
Sequence identity between the two chains	0.99

Chain information

	Chain 1	Chain 2
Model ID	2	1
Chain ID	C	A
UniProt accession	P83820	P83820
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 1ufl-a2-m2-cC_1ufl-a2-m1-cA.pdb.gz

Full biological assembly Download: 1ufl-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

1v3r/1/1:C/1:A 1ufl/1/1:C/1:A 1ufl/2/1:C/1:A 1ufl/2/2:C/2:A 1v3r/1/1:A/1:B 1v3r/1/1:C/1:B 1v3s/1/1:B/1:A 1v3s/1/1:C/1:A 1v3s/1/1:C/1:B 1v9o/1/1:B/1:A 1v9o/1/1:C/1:A 1v9o/1/1:C/1:B 1vfj/1/1:B/1:A 1vfj/1/1:C/1:A 1vfj/1/1:C/1:B