1waa/1/1:C/1:D

Sequences
>1waa-a1-m1-cC (length=93) [Search sequence]
GAMALIEVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLAASPDCEIIEDGKKH
ILILHNCQLGMTGEVSFQAANTKSAANLKVKEL
>1waa-a1-m1-cD (length=93) [Search sequence]
GAMALIEVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLAASPDCEIIEDGKKH
ILILHNCQLGMTGEVSFQAANTKSAANLKVKEL
Structure information
PDB ID 1waa (database links: RCSB PDB PDBe PDBj PDBsum)
Title IG27 protein domain
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
PubMed citation 19282960
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q8WZ42 Q8WZ42
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:1waaC BioLiP:1waaD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1waa-a1-m1-cC_1waa-a1-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1waa-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1waa/1/1:A/1:F 1waa/1/1:B/1:A 1waa/1/1:E/1:C 1waa/1/1:E/1:D
Other dimers with similar sequences but different poses
  • 1waa/1/1:A/1:D 1waa/1/1:B/1:C
  • 1waa/1/1:C/1:F 1waa/1/1:B/1:D
  • [Back to Home]