1waa/1/1:C/1:D

Sequences

>1waa-a1-m1-cC (length=93) [Search sequence]

GAMALIEVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLAASPDCEIIEDGKKH ILILHNCQLGMTGEVSFQAANTKSAANLKVKEL

>1waa-a1-m1-cD (length=93) [Search sequence]

GAMALIEVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLAASPDCEIIEDGKKH ILILHNCQLGMTGEVSFQAANTKSAANLKVKEL

Structure information

PDB ID	1waa (database links: RCSB PDB PDBe PDBj PDBsum)
Title	IG27 protein domain
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	15
Sequence identity between the two chains	1.0
PubMed citation	19282960

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q8WZ42	Q8WZ42
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:1waaC	BioLiP:1waaD

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 1waa-a1-m1-cC_1waa-a1-m1-cD.pdb.gz

Full biological assembly Download: 1waa-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1waa/1/1:A/1:F 1waa/1/1:B/1:A 1waa/1/1:E/1:C 1waa/1/1:E/1:D
Other dimers with similar sequences but different poses	1waa/1/1:A/1:D 1waa/1/1:B/1:C 1waa/1/1:C/1:F 1waa/1/1:B/1:D