1wmg/1/1:F/1:E

Sequences

>1wmg-a1-m1-cF (length=83) [Search sequence]

AFKIPLSIRQKICSSLDAPNSRGNDWRLLAQKLSDRYLNYFATKASPTGVILDLWEARQQ DDGDLNSLASALEEGKSELVAAT

>1wmg-a1-m1-cE (length=84) [Search sequence]

YAFKIPLSIRQKICSSLDAPNSRGNDWRLLAQKLSDRYLNYFATKASPTGVILDLWEARQ QDDGDLNSLASALEEGKSELVAAT

Structure information

PDB ID	1wmg (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the UNC5H2 death domain
Assembly ID	1
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	28
Sequence identity between the two chains	1.0
PubMed citation	17139086

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	E
UniProt accession	Q8K1S3	Q8K1S3
Species	10090 (Mus musculus)	10090 (Mus musculus)
Function annotation	BioLiP:1wmgE

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1wmg-a1-m1-cF_1wmg-a1-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1wmg-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1wmg/1/1:B/1:A 1wmg/1/1:D/1:C
Other dimers with similar sequences but different poses	1wmg/1/1:F/1:A 1wmg/1/1:B/1:C