1x3e/1/2:A/2:B

Sequences
>1x3e-a1-m2-cA (length=110) [Search sequence]
GDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMEWKDGEALFLRCNIWREAAENVA
ESLTRGSRVIVTGRLKQRSFETREKRTVVEVEVDEIGPSLRYATAKVNKA
>1x3e-a1-m2-cB (length=119) [Search sequence]
AGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEWKDGEALFLRCNIWR
EAAENVAESLTRGSRVIVTGRLKQRSFETREGEKRTVVEVEVDEIGPSLRYATAKVNKA
Structure information
PDB ID 1x3e (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the single-stranded DNA-binding protein from Mycobacterium smegmatis
Assembly ID 1
Resolution 2.15Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 112
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession Q9AFI5 Q9AFI5
Species 1772 (Mycolicibacterium smegmatis) 1772 (Mycolicibacterium smegmatis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1x3e-a1-m2-cA_1x3e-a1-m2-cB.pdb.gz
Full biological assembly
Download: 1x3e-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1x3e/1/1:A/1:B 3a5u/1/1:B/2:B
Other dimers with similar sequences but different poses
  • 1x3e/1/1:A/2:A 1x3f/1/1:A/2:A
  • [Back to Home]