2ask/3/3:A/3:B

Sequences

>2ask-a3-m3-cA (length=101) [Search sequence]

ARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPG SRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG

>2ask-a3-m3-cB (length=101) [Search sequence]

ARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPG SRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG

Structure information

PDB ID	2ask (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of human Artemin
Assembly ID	3
Resolution	1.55Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	144
Sequence identity between the two chains	1.0
PubMed citation	16734417

Chain information

	Chain 1	Chain 2
Model ID	3	3
Chain ID	A	B
UniProt accession	Q5T4W7	Q5T4W7
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:2askA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2ask-a3-m3-cA_2ask-a3-m3-cB.pdb.gz

Full biological assembly Download: 2ask-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2ask/1/1:A/1:B 2ask/2/1:A/1:B 2ask/2/2:A/2:B 2ask/3/1:A/1:B 2gh0/1/1:D/1:C 2gyr/1/1:A/1:B 2gyr/2/1:C/1:D 2gyr/3/1:E/1:F 2gyz/1/1:A/2:A 6q2s/1/1:A/1:B
Other dimers with similar sequences but different poses	2ask/2/1:A/2:B 2ask/2/1:B/2:A