2cgz/1/5:A/6:A

Sequences

>2cgz-a1-m5-cA (length=100) [Search sequence]

RVQSGKINCGDDAGWAKVPSDDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQ NLRVIARLYSVSPTGFKASCYTWHNTKVYSMSISWISIEN

>2cgz-a1-m6-cA (length=100) [Search sequence]

RVQSGKINCGDDAGWAKVPSDDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQ NLRVIARLYSVSPTGFKASCYTWHNTKVYSMSISWISIEN

Structure information

PDB ID	2cgz (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of Helix Pomatia agglutinin with Tn antigen
Assembly ID	1
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	55
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	5	6
Chain ID	A	A
UniProt accession	Q2F1K8	Q2F1K8
Species	6536 (Helix pomatia)	6536 (Helix pomatia)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2cgz-a1-m5-cA_2cgz-a1-m6-cA.pdb.gz

Full biological assembly Download: 2cgz-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2ccv/1/1:A/2:A 2ccv/1/1:A/3:A 2ccv/1/2:A/3:A 2ccv/1/4:A/5:A 2ccv/1/4:A/6:A 2ccv/1/5:A/6:A 2ce6/1/1:A/2:A 2ce6/1/1:A/3:A 2ce6/1/2:A/3:A 2ce6/1/4:A/5:A 2ce6/1/4:A/6:A 2ce6/1/5:A/6:A 2cgy/1/1:A/3:A 2cgy/1/1:A/6:A 2cgy/1/2:A/4:A 2cgy/1/2:A/5:A 2cgy/1/3:A/6:A 2cgy/1/4:A/5:A 2cgz/1/1:A/2:A 2cgz/1/1:A/3:A 2cgz/1/2:A/3:A 2cgz/1/4:A/5:A 2cgz/1/4:A/6:A