2fqp/3/2:B/2:A

Sequences

>2fqp-a3-m2-cB (length=90) [Search sequence]

RPGAIPTVQIDNERVKVTEWRFPPGGETGWHRHSDYVVVPTTGPLLLETPEGSVTSQLTR GVSYTRPEGVEHNVINPSDTEFVFVEIEIK

>2fqp-a3-m2-cA (length=92) [Search sequence]

KRPGAIPTVQIDNERVKVTEWRFPPGGETGWHRHSDYVVVPTTGPLLLETPEGSVTSQLT RGVSYTRPEGVEHNVINPSDTEFVFVEIEIKA

Structure information

PDB ID	2fqp (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a cupin domain (bp2299) from bordetella pertussis tohama i at 1.80 A resolution
Assembly ID	3
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	56
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	B	A
UniProt accession	Q7VWF8	Q7VWF8
Species	257313 (Bordetella pertussis Tohama I)	257313 (Bordetella pertussis Tohama I)
Function annotation	BioLiP:2fqpB	BioLiP:2fqpA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2fqp-a3-m2-cB_2fqp-a3-m2-cA.pdb.gz

Full biological assembly Download: 2fqp-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2fqp/1/1:B/1:A 2fqp/2/1:D/1:C 2fqp/3/1:D/1:C