2i3h/7/2:A/1:B

Sequences
>2i3h-a7-m2-cA (length=90) [Search sequence]
GPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRG
DDPWTEHAKWFPGCQFLLRSKGQEYINNIH
>2i3h-a7-m1-cB (length=95) [Search sequence]
GPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRG
DDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL
Structure information
PDB ID 2i3h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of an ML-IAP/XIAP chimera bound to a 4-mer peptide (AVPW)
Assembly ID 7
Resolution 1.62Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
PubMed citation 17168540
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID A B
UniProt accession Q96CA5 Q96CA5
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:2i3hA BioLiP:2i3hB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2i3h-a7-m2-cA_2i3h-a7-m1-cB.pdb.gz
Full biological assembly
Download: 2i3h-assembly7.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1tw6/3/2:A/1:B 1tw6/4/2:A/1:B 2i3h/3/2:A/1:B 2i3h/4/2:A/1:B 2i3h/5/2:A/1:B 2i3h/6/2:A/1:B

[Back to Home]