2i4r/2/2:B/4:B

Sequences

>2i4r-a2-m2-cB (length=77) [Search sequence]

HSHLAVVGDPDFTIGFLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVIKQEYLKKLPPV LRREIDEKVEPTFVSVG

>2i4r-a2-m4-cB (length=77) [Search sequence]

HSHLAVVGDPDFTIGFLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVIKQEYLKKLPPV LRREIDEKVEPTFVSVG

Structure information

PDB ID	2i4r (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the V-type ATP synthase subunit F from Archaeoglobus fulgidus. NESG target GR52A.
Assembly ID	2
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	28
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	4
Chain ID	B	B
UniProt accession	O29102	O29102
Species	2234 (Archaeoglobus fulgidus)	2234 (Archaeoglobus fulgidus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2i4r-a2-m2-cB_2i4r-a2-m4-cB.pdb.gz

Full biological assembly Download: 2i4r-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2i4r/2/1:A/2:A 2i4r/2/1:B/3:B 2i4r/2/3:A/4:A
Other dimers with similar sequences but different poses	2i4r/2/4:A/4:B 2i4r/1/1:A/1:B 2i4r/2/1:A/1:B 2i4r/2/2:A/2:B 2i4r/2/3:A/3:B 2i4r/2/3:A/4:B 2i4r/2/1:A/2:B 2i4r/2/1:A/3:B 2i4r/2/2:A/1:B 2i4r/2/2:A/4:B 2i4r/2/3:A/1:B 2i4r/2/4:A/2:B 2i4r/2/4:A/3:B