2nnc/1/1:A/2:A

Sequences

>2nnc-a1-m1-cA (length=110) [Search sequence]

SASKLDDAIAAKFGSLPIQESTAIQIKAPEIAENGAFVPVTVATSIPGATNISIFTPANF SPMVASFDVLPRMKPEVSLRMRMAKTENLVVVVQAGGKLYRAVREVKVTI

>2nnc-a1-m2-cA (length=110) [Search sequence]

SASKLDDAIAAKFGSLPIQESTAIQIKAPEIAENGAFVPVTVATSIPGATNISIFTPANF SPMVASFDVLPRMKPEVSLRMRMAKTENLVVVVQAGGKLYRAVREVKVTI

Structure information

PDB ID	2nnc (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the sulfur carrier protein SoxY from Chlorobium limicola f thiosulfatophilum
Assembly ID	1
Resolution	2.14Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	26
Sequence identity between the two chains	1.0
PubMed citation	17327392

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	A
UniProt accession	Q8RLX2	Q8RLX2
Species	1092 (Chlorobium limicola)	1092 (Chlorobium limicola)
Function annotation	BioLiP:2nncA	BioLiP:2nncA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2nnc-a1-m1-cA_2nnc-a1-m2-cA.pdb.gz

Full biological assembly Download: 2nnc-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

2nnc/1/2:A/2:B 2nnc/1/1:A/1:B 2nnf/1/1:A/1:B 2nnf/1/2:A/2:B 2nnc/1/1:A/2:B 2nnc/1/2:A/1:B 2nnf/1/1:A/2:B 2nnf/1/2:A/1:B