2ota/1/1:B/1:A

Sequences

>2ota-a1-m1-cB (length=60) [Search sequence]

NERVEKIIQDLLDVLVKEEVTPDLALCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVL

>2ota-a1-m1-cA (length=66) [Search sequence]

YSNERVEKIIQDLLDVLVKEEVTPDLALCLGNAVTNIIAQVPESKRVAVVDNFTKALKQS VLEHHH

Structure information

PDB ID	2ota (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the UPF0352 protein CPS_2611 from Colwellia psychrerythraea. NESG target CsR4.
Assembly ID	1
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	135
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q481E4	Q481E4
Species	167879 (Colwellia psychrerythraea 34H)	167879 (Colwellia psychrerythraea 34H)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2ota-a1-m1-cB_2ota-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2ota-assembly1.cif.gz

Similar dimers