2otk/1/1:E/1:F

Sequences

>2otk-a1-m1-cE (length=43) [Search sequence]

GEIVYLPNLNPDQLCAFIHSLHDDPSQSANLLAEAKKLNDAQA

>2otk-a1-m1-cF (length=43) [Search sequence]

GEIVYLPNLNPDQLCAFIHSLHDDPSQSANLLAEAKKLNDAQA

Structure information

PDB ID	2otk (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of Alzheimer Ab peptide in complex with an engineered binding protein
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	19
Sequence identity between the two chains	1.0
PubMed citation	18375754

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	F
UniProt accession
Species
Function annotation	BioLiP:2otkE	BioLiP:2otkF

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2otk-a1-m1-cE_2otk-a1-m1-cF.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2otk-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4bxl/1/1:A/1:B 5k5g/1/1:B/1:C