2otk/1/1:E/1:F

Sequences
>2otk-a1-m1-cE (length=43) [Search sequence]
GEIVYLPNLNPDQLCAFIHSLHDDPSQSANLLAEAKKLNDAQA
>2otk-a1-m1-cF (length=43) [Search sequence]
GEIVYLPNLNPDQLCAFIHSLHDDPSQSANLLAEAKKLNDAQA
Structure information
PDB ID 2otk (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Alzheimer Ab peptide in complex with an engineered binding protein
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 19
Sequence identity between the two chains 1.0
PubMed citation 18375754
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E F
UniProt accession
Species
Function annotation BioLiP:2otkE BioLiP:2otkF
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2otk-a1-m1-cE_2otk-a1-m1-cF.pdb.gz
Full biological assembly
Download: 2otk-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4bxl/1/1:A/1:B 5k5g/1/1:B/1:C

[Back to Home]