2pls/1/1:B/1:C

Sequences

>2pls-a1-m1-cB (length=83) [Search sequence]

SNAVQREDGSWLLDGLIAVPELKDTLGLRAVPEEEKGVYHTLSGIWLLGRLPQTGDITFW ENWRLEVIDDSKRIDKVLATKID

>2pls-a1-m1-cC (length=83) [Search sequence]

SNAVQREDGSWLLDGLIAVPELKDTLGLRAVPEEEKGVYHTLSGIWLLGRLPQTGDITFW ENWRLEVIDDSKRIDKVLATKID

Structure information

PDB ID	2pls (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural Genomics, the crystal structure of the CorC/HlyC transporter associated domain of a CBS domain protein from Chlorobium tepidum TLS
Assembly ID	1
Resolution	2.15Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	16
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	Q8KEZ1	Q8KEZ1
Species	194439 (Chlorobaculum tepidum TLS)	194439 (Chlorobaculum tepidum TLS)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2pls-a1-m1-cB_2pls-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2pls-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2pls/1/1:A/1:B 2pls/1/1:A/1:C 2pls/2/1:D/1:E 2pls/2/1:D/1:F 2pls/2/1:E/1:F
Other dimers with similar sequences but different poses	2pls/6/1:L/2:L 2pls/3/1:G/1:H 2pls/4/1:I/1:J 2pls/5/1:K/2:K