2pls/1/1:B/1:C

Sequences
>2pls-a1-m1-cB (length=83) [Search sequence]
SNAVQREDGSWLLDGLIAVPELKDTLGLRAVPEEEKGVYHTLSGIWLLGRLPQTGDITFW
ENWRLEVIDDSKRIDKVLATKID
>2pls-a1-m1-cC (length=83) [Search sequence]
SNAVQREDGSWLLDGLIAVPELKDTLGLRAVPEEEKGVYHTLSGIWLLGRLPQTGDITFW
ENWRLEVIDDSKRIDKVLATKID
Structure information
PDB ID 2pls (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural Genomics, the crystal structure of the CorC/HlyC transporter associated domain of a CBS domain protein from Chlorobium tepidum TLS
Assembly ID 1
Resolution 2.15Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 16
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession Q8KEZ1 Q8KEZ1
Species 194439 (Chlorobaculum tepidum TLS) 194439 (Chlorobaculum tepidum TLS)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2pls-a1-m1-cB_2pls-a1-m1-cC.pdb.gz
Full biological assembly
Download: 2pls-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2pls/1/1:A/1:B 2pls/1/1:A/1:C 2pls/2/1:D/1:E 2pls/2/1:D/1:F 2pls/2/1:E/1:F
Other dimers with similar sequences but different poses
  • 2pls/6/1:L/2:L 2pls/3/1:G/1:H 2pls/4/1:I/1:J 2pls/5/1:K/2:K
  • [Back to Home]