2r1j/1/1:L/1:R

Sequences

>2r1j-a1-m1-cL (length=66) [Search sequence]

TQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPD YLLKGD

>2r1j-a1-m1-cR (length=66) [Search sequence]

TQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPD YLLKGD

Structure information

PDB ID	2r1j (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the P22 c2 Repressor protein in complex with the synthetic operator 9T
Assembly ID	1
Resolution	1.53Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	33
Sequence identity between the two chains	1.0
PubMed citation	18237194

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	L	R
UniProt accession	P69202	P69202
Species	10754 (Lederbergvirus P22)	10754 (Lederbergvirus P22)
Function annotation	BioLiP:2r1jL	BioLiP:2r1jR

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2r1j-a1-m1-cL_2r1j-a1-m1-cR.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2r1j-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3jxb/1/1:D/1:C 3jxc/1/1:L/1:R 3jxd/1/1:L/1:R