2xg8/1/2:D/2:E

Sequences

>2xg8-a1-m2-cD (length=87) [Search sequence]

SENYLNHPTFGLLYQICSFGDSKELFATLYAQRLFFLVAFDARGTRFEPIGRNEARMLVD NRLRQLRRDASLQEYNQLQQVFKQTFL

>2xg8-a1-m2-cE (length=87) [Search sequence]

SENYLNHPTFGLLYQICSFGDSKELFATLYAQRLFFLVAFDARGTRFEPIGRNEARMLVD NRLRQLRRDASLQEYNQLQQVFKQTFL

Structure information

PDB ID	2xg8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural basis of gene regulation by protein PII: The crystal complex of PII and PipX from Synechococcus elongatus PCC 7942
Assembly ID	1
Resolution	3.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	19
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	D	E
UniProt accession	Q7X386	Q7X386
Species	1140 (Synechococcus elongatus PCC 7942 = FACHB-805)	1140 (Synechococcus elongatus PCC 7942 = FACHB-805)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2xg8-a1-m2-cD_2xg8-a1-m2-cE.pdb.gz

Full biological assembly Download: 2xg8-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2xg8/1/1:D/1:E 2xg8/1/1:F/1:D 2xg8/1/1:F/1:E 2xg8/1/2:F/2:D 2xg8/1/2:F/2:E