2xmv/1/1:E/1:F

Sequences

>2xmv-a1-m1-cE (length=63) [Search sequence]

TIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGY EVE

>2xmv-a1-m1-cF (length=63) [Search sequence]

TIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGY EVE

Structure information

PDB ID	2xmv (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Copper chaperone Atx1 from Synechocystis PCC6803 (Cu1, trimeric form, His61Tyr mutant)
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	21
Sequence identity between the two chains	1.0
PubMed citation	20726513

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	F
UniProt accession	P73213	P73213
Species	1148 (Synechocystis sp. PCC 6803)	1148 (Synechocystis sp. PCC 6803)
Function annotation	BioLiP:2xmvE	BioLiP:2xmvF

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2xmv-a1-m1-cE_2xmv-a1-m1-cF.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2xmv-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2xmv/1/1:A/1:B 2xmv/1/1:A/1:C 2xmv/1/1:B/1:C 2xmv/1/1:D/1:E 2xmv/1/1:D/1:F
Other dimers with similar sequences but different poses	4a47/2/1:B/3:B 2xmj/1/1:B/1:A 2xmk/1/1:A/1:B 2xmm/1/1:A/1:B 4a46/1/1:A/1:B 4a46/1/1:C/1:D 4a47/1/1:A/2:A 4a47/3/1:C/2:C 4a47/4/1:D/3:D 2xmt/1/1:A/1:B 2xmu/1/1:A/1:B 2xmv/1/1:A/1:F 2xmv/1/1:B/1:E 2xmv/1/1:C/1:D