2xzz/1/10:A/9:A

Sequences

>2xzz-a1-m10-cA (length=97) [Search sequence]

SMLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETV TLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVA

>2xzz-a1-m9-cA (length=97) [Search sequence]

SMLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETV TLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVA

Structure information

PDB ID	2xzz (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the human transglutaminase 1 beta-barrel domain
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	31
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	10	9
Chain ID	A	A
UniProt accession	P22735	P22735
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2xzz-a1-m10-cA_2xzz-a1-m9-cA.pdb.gz

Full biological assembly Download: 2xzz-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2xzz/1/11:A/18:A 2xzz/1/12:A/13:A 2xzz/1/15:A/8:A 2xzz/1/16:A/20:A 2xzz/1/17:A/21:A 2xzz/1/19:A/22:A 2xzz/1/1:A/14:A 2xzz/1/23:A/5:A 2xzz/1/24:A/4:A 2xzz/1/2:A/3:A 2xzz/1/6:A/7:A

Other dimers with similar sequences but different poses

2xzz/1/24:A/9:A 2xzz/1/10:A/14:A 2xzz/1/10:A/15:A 2xzz/1/11:A/22:A 2xzz/1/11:A/4:A 2xzz/1/12:A/19:A 2xzz/1/12:A/2:A 2xzz/1/13:A/14:A 2xzz/1/13:A/15:A 2xzz/1/16:A/5:A 2xzz/1/16:A/7:A 2xzz/1/17:A/23:A 2xzz/1/17:A/9:A 2xzz/1/18:A/5:A 2xzz/1/18:A/7:A 2xzz/1/19:A/6:A 2xzz/1/1:A/22:A 2xzz/1/1:A/4:A 2xzz/1/20:A/21:A 2xzz/1/20:A/3:A 2xzz/1/21:A/8:A 2xzz/1/23:A/24:A 2xzz/1/2:A/6:A 2xzz/1/3:A/8:A 2xzz/1/4:A/9:A 2xzz/1/10:A/17:A 2xzz/1/10:A/8:A 2xzz/1/11:A/24:A 2xzz/1/11:A/5:A 2xzz/1/12:A/15:A 2xzz/1/12:A/3:A 2xzz/1/13:A/19:A 2xzz/1/14:A/4:A 2xzz/1/14:A/9:A 2xzz/1/15:A/3:A 2xzz/1/16:A/21:A 2xzz/1/16:A/23:A 2xzz/1/17:A/8:A 2xzz/1/18:A/22:A 2xzz/1/18:A/6:A 2xzz/1/1:A/13:A 2xzz/1/1:A/19:A 2xzz/1/20:A/7:A 2xzz/1/21:A/23:A 2xzz/1/22:A/6:A 2xzz/1/24:A/5:A 2xzz/1/2:A/20:A 2xzz/1/2:A/7:A