2yyr/1/1:A/1:B

Sequences

>2yyr-a1-m1-cA (length=58) [Search sequence]

PVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGTETAYGLLTAEASAVWGCDTCAD

>2yyr-a1-m1-cB (length=58) [Search sequence]

PVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGTETAYGLLTAEASAVWGCDTCAD

Structure information

PDB ID	2yyr (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural analysis of PHD domain of Pygopus complexed with trimethylated histone H3 peptide
Assembly ID	1
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	36
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q9D0P5	Q9D0P5
Species	10090 (Mus musculus)	10090 (Mus musculus)
Function annotation	BioLiP:2yyrA	BioLiP:2yyrB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2yyr-a1-m1-cA_2yyr-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2yyr-assembly1.cif.gz

Similar dimers