3bid/4/1:H/1:G

Sequences

>3bid-a4-m1-cH (length=56) [Search sequence]

YFEIYKDAKGEYRWRLKAANHEIIAQGEGYTSKQNCQHAVDLLKSTTAATPVKEVL

>3bid-a4-m1-cG (length=59) [Search sequence]

YFEIYKDAKGEYRWRLKAANHEIIAQGEGYTSKQNCQHAVDLLKSTTAATPVKEVLEHH

Structure information

PDB ID	3bid (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the NMB1088 protein from Neisseria meningitidis. Northeast Structural Genomics Consortium target MR91
Assembly ID	4
Resolution	2.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	88
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	H	G
UniProt accession	Q7DDI1	Q7DDI1
Species	122586 (Neisseria meningitidis MC58)	122586 (Neisseria meningitidis MC58)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3bid-a4-m1-cH_3bid-a4-m1-cG.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3bid-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3bid/1/1:B/1:A 3bid/2/1:D/1:C 3bid/3/1:F/1:E