3bw1/1/4:A/4:B

Sequences

>3bw1-a1-m4-cA (length=86) [Search sequence]

HHMETPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSE SERRCEMVFIRGDTVTLISTPSAVEI

>3bw1-a1-m4-cB (length=86) [Search sequence]

HHMETPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSE SERRCEMVFIRGDTVTLISTPSAVEI

Structure information

PDB ID	3bw1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of homomeric yeast Lsm3 exhibiting novel octameric ring organisation
Assembly ID	1
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	60
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	4	4
Chain ID	A	B
UniProt accession	P57743	P57743
Species	4932 (Saccharomyces cerevisiae)	4932 (Saccharomyces cerevisiae)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3bw1-a1-m4-cA_3bw1-a1-m4-cB.pdb.gz

Full biological assembly Download: 3bw1-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3bw1/1/1:A/1:B 3bw1/1/1:A/3:B 3bw1/1/1:B/4:A 3bw1/1/2:A/2:B 3bw1/1/2:A/4:B 3bw1/1/2:B/3:A 3bw1/1/3:A/3:B
Other dimers with similar sequences but different poses	4n0a/1/1:A/2:B 4m7a/3/1:C/1:J 4n0a/1/1:B/2:A