3eg1/1/1:B/1:A

Sequences

>3eg1-a1-m1-cB (length=56) [Search sequence]

NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPV

>3eg1-a1-m1-cA (length=58) [Search sequence]

NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS

Structure information

PDB ID	3eg1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the N114Q mutant of ABL-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions
Assembly ID	1
Resolution	1.85Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	22
Sequence identity between the two chains	1.0
PubMed citation	19906645

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P00519	P00519
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3eg1B	BioLiP:3eg1A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3eg1-a1-m1-cB_3eg1-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3eg1-assembly1.cif.gz