3f6w/5/1:C/1:D

Sequences

>3f6w-a5-m1-cC (length=80) [Search sequence]

NATKTIHNARYQALLDLLLEARSAAGITQKELAARLGRPQSFVSKTENAERRLDVIEFDF CRGIGTDPYALLSKLEATPS

>3f6w-a5-m1-cD (length=80) [Search sequence]

SNATKTIHNARYQALLDLLLEARSAAGITQKELAARLGRPQSFVSKTENAERRLDVIEFD FCRGIGTDPYALLSKLEATP

Structure information

PDB ID	3f6w (database links: RCSB PDB PDBe PDBj PDBsum)
Title	XRE-family like protein from Pseudomonas syringae pv. tomato str. DC3000
Assembly ID	5
Resolution	1.85Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	46
Sequence identity between the two chains	0.988

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q889N2	Q889N2
Species	223283 (Pseudomonas syringae pv. tomato str. DC3000)	223283 (Pseudomonas syringae pv. tomato str. DC3000)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3f6w-a5-m1-cC_3f6w-a5-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3f6w-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3f6w/2/1:A/1:B 3f6w/6/1:E/4:E
Other dimers with similar sequences but different poses	3f6w/3/1:B/3:D 3f6w/1/1:A/2:A 3f6w/4/1:E/1:C